Clone Name | rbart43a05 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | YV04_HUMAN (Q8TCH9) Protein FLJ23865 | 30 | 2.4 | 2 | GRN_MOUSE (P28798) Granulins precursor (Proepithelin) (PEPI) (PC... | 28 | 6.9 |
---|
>YV04_HUMAN (Q8TCH9) Protein FLJ23865| Length = 128 Score = 30.0 bits (66), Expect = 2.4 Identities = 13/36 (36%), Positives = 19/36 (52%), Gaps = 8/36 (22%) Frame = +1 Query: 319 WFCHHFCHELPPCY--------RDLA*MMAVSGCEI 402 WFC+H CH+ PP + +LA +A S C + Sbjct: 85 WFCNHHCHQHPPSHLTEVLQSSGELAHQLAPSRCSM 120
>GRN_MOUSE (P28798) Granulins precursor (Proepithelin) (PEPI) (PC cell-derived| growth factor) (PCDGF) [Contains: Acrogranin; Granulin-1; Granulin-2; Granulin-3; Granulin-4; Granulin-5; Granulin-6; Granulin-7] Length = 589 Score = 28.5 bits (62), Expect = 6.9 Identities = 13/31 (41%), Positives = 16/31 (51%) Frame = +1 Query: 331 HFCHELPPCYRDLA*MMAVSGCEICCCYLQG 423 HFCH+ C +D A G CC YL+G Sbjct: 521 HFCHDNQTCCKDSA------GVWACCPYLKG 545 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 51,907,300 Number of Sequences: 219361 Number of extensions: 886010 Number of successful extensions: 1858 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 1828 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1858 length of database: 80,573,946 effective HSP length: 101 effective length of database: 58,418,485 effective search space used: 2336739400 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)