Clone Name | rbart42h11 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | AGO1_SCHPO (O74957) Cell cycle control protein ago1 (RNA interfe... | 31 | 1.3 |
---|
>AGO1_SCHPO (O74957) Cell cycle control protein ago1 (RNA interference pathway| protein ago1) Length = 834 Score = 31.2 bits (69), Expect = 1.3 Identities = 18/53 (33%), Positives = 27/53 (50%) Frame = -3 Query: 389 GGGSKAWRGVYQPNDDKLQFFYDGQGFMSLQLNKDQADFIFYDVSGKVLYEWT 231 GGG +AW+G YQ QGFMS+ ++ + F D ++L E+T Sbjct: 174 GGGVEAWKGFYQS-------IRPNQGFMSVNVDISSSAFWRNDSLLQILMEYT 219 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 69,524,753 Number of Sequences: 219361 Number of extensions: 1369943 Number of successful extensions: 2994 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 2910 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2991 length of database: 80,573,946 effective HSP length: 102 effective length of database: 58,199,124 effective search space used: 2968155324 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)