| Clone Name | rbart42h09 |
|---|---|
| Clone Library Name | barley_pub |
>KR122_HUMAN (P59991) Keratin-associated protein 12-2 (Keratin-associated| protein 12.2) (High sulfur keratin-associated protein 12.2) Length = 146 Score = 31.6 bits (70), Expect = 0.47 Identities = 20/53 (37%), Positives = 24/53 (45%), Gaps = 4/53 (7%) Frame = -3 Query: 269 CGVGCYSACPLQCCA---CLRFVCVSIDLDRFSCSVLVVCR-SVAAPCGFRPS 123 C C S C CCA C CV + SC V V C+ SV P F+P+ Sbjct: 2 CHTSCSSGCQPACCAPSPCQPACCVPSSC-QASCCVPVGCQSSVCVPVSFKPA 53
>KRUC_SHEEP (P26372) Keratin, ultra high-sulfur matrix protein (UHS keratin)| Length = 182 Score = 30.4 bits (67), Expect = 1.1 Identities = 19/58 (32%), Positives = 27/58 (46%), Gaps = 9/58 (15%) Frame = -3 Query: 302 GSRHSFTTILACGVGCYSAC--PLQCC-------ACLRFVCVSIDLDRFSCSVLVVCR 156 GS+ + CG GC S+C P+ CC +C + C S + SC V V C+ Sbjct: 122 GSKGGCGSCGGCGSGCGSSCCVPVCCCVPACSCSSCGKGGCGSCGCSQSSCCVPVCCQ 179
>KR10B_HUMAN (P60412) Keratin-associated protein 10-11 (Keratin-associated| protein 10.11) (High sulfur keratin-associated protein 10.11) (Keratin-associated protein 18-11) (Keratin-associated protein 18.11) Length = 298 Score = 30.0 bits (66), Expect = 1.4 Identities = 16/44 (36%), Positives = 22/44 (50%), Gaps = 3/44 (6%) Frame = -3 Query: 272 ACGVGCYSACPLQCC---ACLRFVCVSIDLDRFSCSVLVVCRSV 150 AC GC S+C CC +C C S + +C V V C++V Sbjct: 66 ACQSGCTSSCTPSCCQQSSCQPACCTSSPCQQ-ACCVPVCCKTV 108
>HUG1_HUMAN (O75698) Protein HUG-1 (HOX11 upstream gene 1 protein)| Length = 362 Score = 29.6 bits (65), Expect = 1.8 Identities = 25/83 (30%), Positives = 35/83 (42%), Gaps = 1/83 (1%) Frame = +1 Query: 145 AATLLHTTNTEQENR-SRSIETHTNRRHAQHWSGQAL*HPTPHASMVVKLWREPSQSGHA 321 A LLH+ + R +RS +THT R A +WS P+PH + P +S Sbjct: 108 ALVLLHSRAHGRTPRPTRSSQTHTTLRKAPNWSNSQQ-WPSPHPPLA------PPRSSFP 160 Query: 322 G*ARLGVEDGGALEAVGRVLAAG 390 G + G L G+ A G Sbjct: 161 TFVGKGHRNAGQLRRTGQRRATG 183
>NPT2B_RAT (Q9JJ09) Sodium-dependent phosphate transport protein 2B| (Sodium/phosphate cotransporter 2B) (Na(+)/Pi cotransporter 2B) (Sodium-phosphate transport protein 2B) (Na(+)-dependent phosphate cotransporter 2B) (NaPi-2b) (Solute carrier family 34 me Length = 695 Score = 29.3 bits (64), Expect = 2.3 Identities = 11/36 (30%), Positives = 17/36 (47%) Frame = -3 Query: 314 PLWLGSRHSFTTILACGVGCYSACPLQCCACLRFVC 207 PLW+ S + I++ C+ +CC C R C Sbjct: 594 PLWMHSLKPWDNIISLATSCFQR---RCCCCCRVCC 626
>KR102_HUMAN (P60368) Keratin-associated protein 10-2 (Keratin-associated| protein 10.2) (High sulfur keratin-associated protein 10.2) (Keratin-associated protein 18-2) (Keratin-associated protein 18.2) Length = 255 Score = 29.3 bits (64), Expect = 2.3 Identities = 16/44 (36%), Positives = 21/44 (47%), Gaps = 3/44 (6%) Frame = -3 Query: 272 ACGVGCYSACPLQCC---ACLRFVCVSIDLDRFSCSVLVVCRSV 150 AC GC S+C CC +C C S + +C V V C+ V Sbjct: 66 ACQSGCTSSCTPSCCQQSSCQPACCTSSPCQQ-ACCVPVCCKPV 108
>KR104_HUMAN (P60372) Keratin-associated protein 10-4 (Keratin-associated| protein 10.4) (High sulfur keratin-associated protein 10.4) (Keratin-associated protein 18-4) (Keratin-associated protein 18.4) Length = 401 Score = 29.3 bits (64), Expect = 2.3 Identities = 15/43 (34%), Positives = 21/43 (48%), Gaps = 3/43 (6%) Frame = -3 Query: 269 CGVGCYSACPLQCC---ACLRFVCVSIDLDRFSCSVLVVCRSV 150 C GC S+C CC +C C S + +C V V C++V Sbjct: 196 CQSGCISSCTPSCCQQSSCQPACCTSSSCQQ-ACCVPVCCKTV 237 Score = 28.5 bits (62), Expect = 4.0 Identities = 15/43 (34%), Positives = 21/43 (48%), Gaps = 3/43 (6%) Frame = -3 Query: 269 CGVGCYSACPLQCC---ACLRFVCVSIDLDRFSCSVLVVCRSV 150 C GC S+C CC +C C S + +C V V C++V Sbjct: 77 CQSGCTSSCTPSCCQQSSCQLACCASSPCQQ-ACCVPVCCKTV 118
>RYR1_PIG (P16960) Ryanodine receptor 1 (Skeletal muscle-type ryanodine| receptor) (RyR1) (RYR-1) (Skeletal muscle calcium release channel) Length = 5035 Score = 28.9 bits (63), Expect = 3.1 Identities = 14/37 (37%), Positives = 20/37 (54%) Frame = -2 Query: 402 GLLITCGKHPPNGFQCPTVLDA*PSLACMAALARLSP 292 G+ +T PP+ F P + A P++ A ARLSP Sbjct: 1765 GVGVTTSLRPPHHFSAPCFVAALPAVGAAEAPARLSP 1801
>KR106_HUMAN (P60371) Keratin-associated protein 10-6 (Keratin-associated| protein 10.6) (High sulfur keratin-associated protein 10.6) (Keratin-associated protein 18-6) (Keratin-associated protein 18.6) Length = 365 Score = 28.5 bits (62), Expect = 4.0 Identities = 15/43 (34%), Positives = 21/43 (48%), Gaps = 3/43 (6%) Frame = -3 Query: 269 CGVGCYSACPLQCC---ACLRFVCVSIDLDRFSCSVLVVCRSV 150 C GC S+C CC +C C S + +C V V C++V Sbjct: 77 CQSGCTSSCTPSCCQQSSCQLACCASSPCQQ-ACCVPVCCKTV 118
>KR107_HUMAN (P60409) Keratin-associated protein 10-7 (Keratin-associated| protein 10.7) (High sulfur keratin-associated protein 10.7) (Keratin-associated protein 18-7) (Keratin-associated protein 18.7) Length = 370 Score = 28.5 bits (62), Expect = 4.0 Identities = 15/43 (34%), Positives = 21/43 (48%), Gaps = 3/43 (6%) Frame = -3 Query: 269 CGVGCYSACPLQCC---ACLRFVCVSIDLDRFSCSVLVVCRSV 150 C GC S+C CC +C C S + +C V V C++V Sbjct: 77 CQSGCTSSCTPSCCQQSSCQLACCASSPCQQ-ACCVPVCCKTV 118 Score = 28.1 bits (61), Expect = 5.2 Identities = 15/43 (34%), Positives = 20/43 (46%), Gaps = 3/43 (6%) Frame = -3 Query: 269 CGVGCYSACPLQCC---ACLRFVCVSIDLDRFSCSVLVVCRSV 150 C GC S+C CC +C C S + +C V V C+ V Sbjct: 196 CQSGCISSCTPSCCQQSSCKPACCTSSPCQQ-ACCVPVCCKPV 237
>KR10C_HUMAN (P60413) Keratin-associated protein 10-12 (Keratin-associated| protein 10.12) (High sulfur keratin-associated protein 10.12) (Keratin-associated protein 18-12) (Keratin-associated protein 18.12) Length = 245 Score = 28.5 bits (62), Expect = 4.0 Identities = 15/43 (34%), Positives = 21/43 (48%), Gaps = 3/43 (6%) Frame = -3 Query: 269 CGVGCYSACPLQCC---ACLRFVCVSIDLDRFSCSVLVVCRSV 150 C GC S+C CC +C C S + +C V V C++V Sbjct: 72 CQSGCTSSCTPSCCQQSSCQPACCTSSPCQQ-ACCVPVCCKTV 113
>PRF1_LYCES (Q00451) 36.4 kDa proline-rich protein| Length = 346 Score = 28.1 bits (61), Expect = 5.2 Identities = 9/17 (52%), Positives = 13/17 (76%) Frame = -2 Query: 399 LLITCGKHPPNGFQCPT 349 L+ CGK+PP F+CP+ Sbjct: 329 LIDDCGKYPPKDFKCPS 345
>NPT2B_MOUSE (Q9DBP0) Sodium-dependent phosphate transport protein 2B| (Sodium/phosphate cotransporter 2B) (Na(+)/Pi cotransporter 2B) (Sodium-phosphate transport protein 2B) (Na(+)-dependent phosphate cotransporter 2B) (NaPi-2b) (Solute carrier family 34 Length = 697 Score = 28.1 bits (61), Expect = 5.2 Identities = 10/36 (27%), Positives = 17/36 (47%) Frame = -3 Query: 314 PLWLGSRHSFTTILACGVGCYSACPLQCCACLRFVC 207 PLW+ S + +++ C+ +CC C R C Sbjct: 594 PLWMHSLKPWDNVISLATTCFQR---RCCCCCRVCC 626
>KR109_HUMAN (P60411) Keratin-associated protein 10-9 (Keratin-associated| protein 10.9) (High sulfur keratin-associated protein 10.9) (Keratin-associated protein 18-9) (Keratin-associated protein 18.9) Length = 292 Score = 27.7 bits (60), Expect = 6.8 Identities = 15/43 (34%), Positives = 20/43 (46%), Gaps = 3/43 (6%) Frame = -3 Query: 269 CGVGCYSACPLQCC---ACLRFVCVSIDLDRFSCSVLVVCRSV 150 C GC S+C CC +C C S + +C V V C+ V Sbjct: 67 CQSGCTSSCTPSCCQQSSCQPAYCTSSPCQQ-ACCVPVCCKPV 108
>CP003_HUMAN (O95177) Protein C16orf3| Length = 125 Score = 27.7 bits (60), Expect = 6.8 Identities = 19/55 (34%), Positives = 25/55 (45%), Gaps = 1/55 (1%) Frame = -3 Query: 275 LACGVGCYSACPLQCCACLRFVCVSIDLDRFSCSVLVVCRSVA-APCGFRPSDVE 114 +AC VGC +ACP+ C C +C V S+A AP G P + E Sbjct: 44 VACPVGCPAACPVGCPIACPVSC------PVACPVGCPVGSMATAPQGLSPQEWE 92
>KR103_HUMAN (P60369) Keratin-associated protein 10-3 (Keratin-associated| protein 10.3) (High sulfur keratin-associated protein 10.3) (Keratin-associated protein 18-3) (Keratin-associated protein 18.3) Length = 221 Score = 27.7 bits (60), Expect = 6.8 Identities = 15/43 (34%), Positives = 20/43 (46%), Gaps = 3/43 (6%) Frame = -3 Query: 269 CGVGCYSACPLQCC---ACLRFVCVSIDLDRFSCSVLVVCRSV 150 C GC S+C CC +C C S + +C V V C+ V Sbjct: 67 CQSGCTSSCTPSCCQQSSCQPACCTSSPCQQ-ACCVPVCCKPV 108
>SOLI2_RALSO (O30920) Autoinducer synthesis protein solI| Length = 204 Score = 27.3 bits (59), Expect = 8.9 Identities = 14/42 (33%), Positives = 22/42 (52%) Frame = -3 Query: 266 GVGCYSACPLQCCACLRFVCVSIDLDRFSCSVLVVCRSVAAP 141 GV + A P++C V ID+D +C+ L + + AAP Sbjct: 158 GVRAHRAGPVRCIGGRPVVACWIDIDASTCAALGIPSASAAP 199
>RS5_METCA (Q605C9) 30S ribosomal protein S5| Length = 169 Score = 27.3 bits (59), Expect = 8.9 Identities = 16/48 (33%), Positives = 24/48 (50%) Frame = +1 Query: 238 SGQAL*HPTPHASMVVKLWREPSQSGHAG*ARLGVEDGGALEAVGRVL 381 +GQ L HP A+ K+ +P+ G G+ GGA+ AV V+ Sbjct: 80 NGQTLHHPVTAAAGAAKVHMQPASEG------TGIIAGGAMRAVFEVV 121
>DDX18_HUMAN (Q9NVP1) ATP-dependent RNA helicase DDX18 (EC 3.6.1.-) (DEAD box| protein 18) (Myc-regulated DEAD box protein) (MrDb) Length = 670 Score = 27.3 bits (59), Expect = 8.9 Identities = 23/82 (28%), Positives = 34/82 (41%) Frame = +1 Query: 46 LPLQYTDLFASTVLNSTC*LINYSTSLGRKPHGAATLLHTTNTEQENRSRSIETHTNRRH 225 LPL T F T S C L+N +T K G + T + ++ +E Sbjct: 166 LPLGLTGAFEDTSFASLCNLVNENTLKAIKEMGFTNM---TEIQHKSIRPLLEGRDLLAA 222 Query: 226 AQHWSGQAL*HPTPHASMVVKL 291 A+ SG+ L P ++VKL Sbjct: 223 AKTGSGKTLAFLIPAVELIVKL 244
>NPT2B_HUMAN (O95436) Sodium-dependent phosphate transport protein 2B| (Sodium/phosphate cotransporter 2B) (Na(+)/Pi cotransporter 2B) (Sodium-phosphate transport protein 2B) (Na(+)-dependent phosphate cotransporter 2B) (NaPi-2b) (Solute carrier family 34 Length = 690 Score = 27.3 bits (59), Expect = 8.9 Identities = 11/36 (30%), Positives = 17/36 (47%) Frame = -3 Query: 314 PLWLGSRHSFTTILACGVGCYSACPLQCCACLRFVC 207 PLW+ S + +++ GC+ CC C R C Sbjct: 594 PLWMRSLKPWDAVVSKFTGCFQMR---CCCCCRVCC 626
>CLAP1_HUMAN (Q7Z460) CLIP-associating protein 1 (Cytoplasmic linker-associated| protein 1) (Multiple asters homolog 1) Length = 1538 Score = 27.3 bits (59), Expect = 8.9 Identities = 12/25 (48%), Positives = 17/25 (68%) Frame = +3 Query: 183 KSVEVDRDAHKSQARTALERASTVA 257 K++E +D+HK R A E AST+A Sbjct: 1391 KTLEAHKDSHKEVVRAAEEAASTLA 1415
>OXAA_CHLTE (Q8KGG2) Inner membrane protein oxaA| Length = 590 Score = 27.3 bits (59), Expect = 8.9 Identities = 14/31 (45%), Positives = 18/31 (58%) Frame = +2 Query: 311 AAMQARLG*ASRTVGHWKPLGGCLPQVMSSP 403 A +Q+ LG + G PLGGCLP V+ P Sbjct: 415 AKLQSELGRIYKEAGV-NPLGGCLPTVIQMP 444
>SWD2_SCHPO (O60137) Set1 complex component swd2 (Set1C component swd2)| (COMPASS component swd2) (Complex proteins associated with set1 protein swd2) Length = 357 Score = 27.3 bits (59), Expect = 8.9 Identities = 13/36 (36%), Positives = 22/36 (61%) Frame = +1 Query: 112 YSTSLGRKPHGAATLLHTTNTEQENRSRSIETHTNR 219 Y LGR H + +L+H +T+++N R ++ TNR Sbjct: 69 YGAHLGRFTHHSNSLIH-ASTKEDNTVRYLDVVTNR 103 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 57,976,639 Number of Sequences: 219361 Number of extensions: 1193833 Number of successful extensions: 2794 Number of sequences better than 10.0: 23 Number of HSP's better than 10.0 without gapping: 2709 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2786 length of database: 80,573,946 effective HSP length: 110 effective length of database: 56,444,236 effective search space used: 1354661664 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)