| Clone Name | rbart42f12 |
|---|---|
| Clone Library Name | barley_pub |
>PH1_ARATH (Q9ST43) Pleckstrin homology domain-containing protein 1 (AtPH1)| Length = 145 Score = 30.0 bits (66), Expect = 2.3 Identities = 13/36 (36%), Positives = 17/36 (47%) Frame = +1 Query: 235 WMEPTRAKALTSRHTVLKPWRTSHLVDQRGTFRWMK 342 W P R+ LT + +K WR V +RG W K Sbjct: 24 WSNPERSGWLTKQGDYIKTWRRRWFVLKRGKLLWFK 59
>RT04_ARATH (Q31708) Mitochondrial ribosomal protein S4| Length = 362 Score = 29.3 bits (64), Expect = 3.9 Identities = 11/40 (27%), Positives = 26/40 (65%) Frame = +3 Query: 60 RHHRGRNLMLPDRSNPPVTFSIAITLESSDTIPSSNPNKI 179 + + +NL LP R+ P+ ++ +++L S+ T ++P+K+ Sbjct: 264 KRRKDKNLNLPTRTISPIVYNSSLSLYSNSTYCFASPHKL 303
>MTR_NEUCR (P38680) N amino acid transport system protein (Methyltryptophan| resistance protein) Length = 470 Score = 28.9 bits (63), Expect = 5.2 Identities = 15/53 (28%), Positives = 27/53 (50%), Gaps = 1/53 (1%) Frame = -1 Query: 419 YFNEILALLGALNFWPLAIYFPVEMYF-IQRKVPRWSTRWLVLQGFSTVCLLV 264 +F+++LA+ AL + YFP MYF I R + + L + +C ++ Sbjct: 383 FFSDLLAICSALFISGFSFYFPALMYFKITRNDAKSQGKKYFLDALNMLCFVI 435
>TYRP_SHIFL (P0AAD5) Tyrosine-specific transport protein (Tyrosine permease)| Length = 403 Score = 28.5 bits (62), Expect = 6.7 Identities = 12/33 (36%), Positives = 19/33 (57%) Frame = -2 Query: 169 GLELGIVSLLSSVMAMENVTGGLERSGSIRFLP 71 G+ LG+ L+ + N GG ++G+I FLP Sbjct: 289 GVALGLFDYLADLFQRSNTVGGRLQTGAITFLP 321
>TYRP_ECOLI (P0AAD4) Tyrosine-specific transport protein (Tyrosine permease)| Length = 403 Score = 28.5 bits (62), Expect = 6.7 Identities = 12/33 (36%), Positives = 19/33 (57%) Frame = -2 Query: 169 GLELGIVSLLSSVMAMENVTGGLERSGSIRFLP 71 G+ LG+ L+ + N GG ++G+I FLP Sbjct: 289 GVALGLFDYLADLFQRSNTVGGRLQTGAITFLP 321
>COIA1_MOUSE (P39061) Collagen alpha-1(XVIII) chain precursor [Contains:| Endostatin] Length = 1774 Score = 28.1 bits (61), Expect = 8.8 Identities = 12/32 (37%), Positives = 17/32 (53%) Frame = +3 Query: 306 PGGPAGHLPLDEVHLHGEVDGQRPEVERAQQR 401 P GP G P+D HL E+ G + + A Q+ Sbjct: 1326 PPGPPGQFPIDLFHLEAEMKGDKGDRGDAGQK 1357
>GAO1D_WHEAT (O04705) Gibberellin 20 oxidase 1-D (EC 1.14.11.-) (Gibberellin| C-20 oxidase 1-D) (GA 20-oxidase 1-D) (Ta20ox1D) (TaGA20ox1-D) (Protein Wga20) Length = 361 Score = 28.1 bits (61), Expect = 8.8 Identities = 12/28 (42%), Positives = 17/28 (60%) Frame = -2 Query: 394 WARSTSGRWPSTSPWRCTSSSGRCPAGP 311 +A S +GR+ S PW+ T S CP+ P Sbjct: 115 YASSFTGRFASKLPWKETLSFRSCPSDP 142
>GAO1B_WHEAT (O04706) Gibberellin 20 oxidase 1-B (EC 1.14.11.-) (Gibberellin| C-20 oxidase 1-B) (GA 20-oxidase 1-B) (Ta20ox1B) (TaGA20ox1-B) Length = 365 Score = 28.1 bits (61), Expect = 8.8 Identities = 12/28 (42%), Positives = 17/28 (60%) Frame = -2 Query: 394 WARSTSGRWPSTSPWRCTSSSGRCPAGP 311 +A S +GR+ S PW+ T S CP+ P Sbjct: 115 YASSFTGRFASKLPWKETLSFRSCPSDP 142
>GAO1A_WHEAT (O04707) Gibberellin 20 oxidase 1-A (EC 1.14.11.-) (Gibberellin| C-20 oxidase 1-B) (GA 20-oxidase 1-A) (Ta20ox1A) (TaGA20ox1-A) Length = 365 Score = 28.1 bits (61), Expect = 8.8 Identities = 12/28 (42%), Positives = 17/28 (60%) Frame = -2 Query: 394 WARSTSGRWPSTSPWRCTSSSGRCPAGP 311 +A S +GR+ S PW+ T S CP+ P Sbjct: 115 YASSFTGRFASKLPWKETLSFRSCPSDP 142 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 58,316,660 Number of Sequences: 219361 Number of extensions: 1133016 Number of successful extensions: 3019 Number of sequences better than 10.0: 9 Number of HSP's better than 10.0 without gapping: 2927 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3019 length of database: 80,573,946 effective HSP length: 100 effective length of database: 58,637,846 effective search space used: 2286875994 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)