| Clone Name | rbart42f06 |
|---|---|
| Clone Library Name | barley_pub |
>AT11C_HUMAN (Q8NB49) Probable phospholipid-transporting ATPase IG (EC 3.6.3.1)| (ATPase class I type 11C) (ATPase IG) (ATPase IQ) (ATPase class VI type 11C) Length = 1132 Score = 30.4 bits (67), Expect = 2.7 Identities = 10/29 (34%), Positives = 20/29 (68%) Frame = -1 Query: 124 YFFFLRIPRYITTWVYVLLCLFVSLFARV 38 YF F ++ ++TW+ ++L +F+SLF + Sbjct: 1057 YFVFAQMLSSVSTWLAIILLIFISLFPEI 1085
>VGLM_BUNSH (P04875) M polyprotein precursor [Contains: Glycoprotein G2;| Nonstructural protein NS-M; Glycoprotein G1] Length = 1441 Score = 30.0 bits (66), Expect = 3.5 Identities = 12/50 (24%), Positives = 28/50 (56%), Gaps = 8/50 (16%) Frame = -1 Query: 130 ISYFFFLRIPRYITTWVYVLLCLFVSL--------FARVGRLYEQQCDVF 5 I++++F+ I Y TW +++ L + L F+ + +Y ++CD++ Sbjct: 354 INFYYFVCIMNYAVTWGLIIIGLLIGLLFKKYQHRFSNLYAMYCEECDMY 403
>CTRO_MOUSE (P49025) Citron Rho-interacting kinase (EC 2.7.11.1) (CRIK)| (Rho-interacting, serine/threonine-protein kinase 21) Length = 2055 Score = 30.0 bits (66), Expect = 3.5 Identities = 18/47 (38%), Positives = 24/47 (51%), Gaps = 1/47 (2%) Frame = -2 Query: 489 AEEEEEDAH-RQDKDEGLKMKLFXRFHHHHAHDSENEVDEVEELARK 352 AE E E H R+D EG+K KL H EN+V +E + R+ Sbjct: 668 AERELEKLHNREDSSEGIKKKLVEA--EERRHSLENKVKRLETMERR 712
>AT11C_MOUSE (Q9QZW0) Probable phospholipid-transporting ATPase 11C (EC 3.6.3.1)| (Fragment) Length = 347 Score = 29.6 bits (65), Expect = 4.6 Identities = 10/29 (34%), Positives = 20/29 (68%) Frame = -1 Query: 124 YFFFLRIPRYITTWVYVLLCLFVSLFARV 38 YF F ++ ++TW+ ++L +F+SLF + Sbjct: 285 YFVFAQMLCSVSTWLAIILLIFISLFPEI 313
>GARP_PLAFF (P13816) Glutamic acid-rich protein precursor| Length = 678 Score = 29.6 bits (65), Expect = 4.6 Identities = 16/48 (33%), Positives = 23/48 (47%) Frame = -2 Query: 492 DAEEEEEDAHRQDKDEGLKMKLFXRFHHHHAHDSENEVDEVEELARKL 349 DAEE+E+DA D +E + D E E +E EE +K+ Sbjct: 621 DAEEDEDDAEEDDDEEDDDEEDDDEDEDEDEEDEEEEEEEEEESEKKI 668 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 53,746,690 Number of Sequences: 219361 Number of extensions: 923941 Number of successful extensions: 3790 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 3076 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3683 length of database: 80,573,946 effective HSP length: 103 effective length of database: 57,979,763 effective search space used: 3478785780 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)