Clone Name | rbart42f04 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | ECP44_DAUCA (Q9XJ56) Phosphoprotein ECPP44 | 30 | 4.5 | 2 | YTRE_LEPBI (P20464) Hypothetical 22 kDa protein in trpE 5'region | 29 | 5.9 | 3 | FKBP3_CANGA (Q6FKH7) FK506-binding protein 3 (EC 5.2.1.8) (Pepti... | 29 | 7.7 |
---|
>ECP44_DAUCA (Q9XJ56) Phosphoprotein ECPP44| Length = 258 Score = 29.6 bits (65), Expect = 4.5 Identities = 19/49 (38%), Positives = 26/49 (53%), Gaps = 2/49 (4%) Frame = -1 Query: 485 EEEEEDGHRQDKDE--GLKMKLFRRFHHHHAHDSENEVDEVEELARKLG 345 EE EE G ++ K E GLK K+ + HH D+ V+ V E +K G Sbjct: 93 EEVEEGGEKKKKKEKKGLKEKIEEKIHHKE-EDTSVPVEVVTEPEKKKG 140
>YTRE_LEPBI (P20464) Hypothetical 22 kDa protein in trpE 5'region| Length = 189 Score = 29.3 bits (64), Expect = 5.9 Identities = 13/51 (25%), Positives = 24/51 (47%), Gaps = 6/51 (11%) Frame = +2 Query: 74 YINPSGNVTWNTKEKK*EMAE------HYTSRITHSTGNRLTKVIKRPNQP 208 ++NPSG+ +WN +K + + H+T + G + +P QP Sbjct: 135 HLNPSGDRSWNINSQKASICKGCPSSAHFTETLEFHYGKHHQTYVTKPQQP 185
>FKBP3_CANGA (Q6FKH7) FK506-binding protein 3 (EC 5.2.1.8) (Peptidyl-prolyl| cis-trans isomerase) (PPIase) (Rotamase) Length = 437 Score = 28.9 bits (63), Expect = 7.7 Identities = 12/44 (27%), Positives = 21/44 (47%) Frame = -1 Query: 482 EEEEDGHRQDKDEGLKMKLFRRFHHHHAHDSENEVDEVEELARK 351 EE E ++ +E K ++ HHH HD +++ D + K Sbjct: 240 EEIEASEEEESEEEEKKSKHKKHDHHHHHDHDHDHDHEHKSKNK 283 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 54,267,513 Number of Sequences: 219361 Number of extensions: 921476 Number of successful extensions: 3734 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 3127 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3634 length of database: 80,573,946 effective HSP length: 103 effective length of database: 57,979,763 effective search space used: 3420806017 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)