Clone Name | rbart42e12 |
---|---|
Clone Library Name | barley_pub |
>DDHD1_MOUSE (Q80YA3) Probable phospholipase DDHD1 (EC 3.1.1.-) (DDHD domain| protein 1) (Phosphatidic acid-preferring phospholipase A1 homolog) (PA-PLA1) Length = 547 Score = 29.6 bits (65), Expect = 3.5 Identities = 12/27 (44%), Positives = 20/27 (74%) Frame = +1 Query: 313 TKFYRSDALQPAVPAEDPVEDRRQPHA 393 ++F RS A QP+ P++D +ED ++P A Sbjct: 410 SRFGRSSASQPSEPSKDSLEDDKKPSA 436
>PURA_STRAW (Q82ER6) Adenylosuccinate synthetase (EC 6.3.4.4) (IMP--aspartate| ligase) (AdSS) (AMPSase) Length = 427 Score = 29.3 bits (64), Expect = 4.5 Identities = 13/32 (40%), Positives = 20/32 (62%) Frame = -1 Query: 174 FYLHVLPQQIIVPICTYA*GDVLLIDTIVSFS 79 + LH+LP I+ P CT G+ +++D V FS Sbjct: 50 YALHLLPSGILTPECTPVIGNGVVVDPSVLFS 81
>VATA_PYRAB (Q9UXU7) V-type ATP synthase alpha chain (EC 3.6.3.14) (V-type| ATPase subunit A) [Contains: Pab atpA intein (Pab VMA intein)] Length = 1017 Score = 28.9 bits (63), Expect = 5.9 Identities = 12/30 (40%), Positives = 19/30 (63%) Frame = +2 Query: 209 GGWITNLISN*VILAKLQRWSDRMILLYIG 298 GG + L+ N V +L +WSD +++YIG Sbjct: 660 GGNMPTLLHNTVTQHQLAKWSDAQVVIYIG 689
>VATA_PYRHO (O57728) V-type ATP synthase alpha chain (EC 3.6.3.14) (V-type| ATPase subunit A) [Contains: Endonuclease PI-Pho2 (EC 3.1.-.-) (Pho atpA intein) (Pho VMA intein)] Length = 964 Score = 28.9 bits (63), Expect = 5.9 Identities = 12/30 (40%), Positives = 19/30 (63%) Frame = +2 Query: 209 GGWITNLISN*VILAKLQRWSDRMILLYIG 298 GG + L+ N V +L +WSD +++YIG Sbjct: 607 GGNMPTLLHNTVTQHQLAKWSDAQVVIYIG 636
>VPRT_SRV2 (P51518) Protease (EC 3.4.23.-)| Length = 314 Score = 28.9 bits (63), Expect = 5.9 Identities = 11/29 (37%), Positives = 17/29 (58%) Frame = +1 Query: 211 WMDNKSNLELGDFGEATTLVRQDDLIIHW 297 W+D K+ L D G T+++Q+D HW Sbjct: 177 WLDGKAFTGLIDTGADVTIIKQEDWPSHW 205
>VATA_PYRFU (Q8U4A6) V-type ATP synthase alpha chain (EC 3.6.3.14) (V-type| ATPase subunit A) [Contains: Endonuclease PI-Pfu2 (EC 3.1.-.-) (Pfu atpA intein) (Pfu VMA intein)] Length = 1013 Score = 28.5 bits (62), Expect = 7.7 Identities = 12/30 (40%), Positives = 19/30 (63%) Frame = +2 Query: 209 GGWITNLISN*VILAKLQRWSDRMILLYIG 298 GG + L+ N V +L +WSD +++YIG Sbjct: 656 GGNMPTLLHNTVTQHQLAKWSDAQVVVYIG 685 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 50,681,605 Number of Sequences: 219361 Number of extensions: 934397 Number of successful extensions: 2498 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 2458 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2498 length of database: 80,573,946 effective HSP length: 101 effective length of database: 58,418,485 effective search space used: 2628831825 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)