| Clone Name | rbart42e08 |
|---|---|
| Clone Library Name | barley_pub |
>ADH_MYCPN (P75214) Probable NADP-dependent alcohol dehydrogenase (EC 1.1.1.2)| Length = 351 Score = 31.6 bits (70), Expect = 0.51 Identities = 13/43 (30%), Positives = 27/43 (62%) Frame = -3 Query: 305 LPKLDMSVGPLSEIVGGGLKKYKTLRVDEVAKVVFSSKLDGKK 177 +P+++ VG + + GGL LR++++A+++ + KLD K Sbjct: 276 IPRVEWGVGMAHKAIHGGLMLGGRLRLEKLARLIMTKKLDPSK 318
>TBB_ENCCU (Q8SS99) Tubulin beta chain (Beta tubulin)| Length = 439 Score = 30.8 bits (68), Expect = 0.87 Identities = 13/51 (25%), Positives = 27/51 (52%) Frame = -3 Query: 344 NPHKERMSISAFHLPKLDMSVGPLSEIVGGGLKKYKTLRVDEVAKVVFSSK 192 N +++++ P+L V + ++ G +K+KT V E+ + +F SK Sbjct: 247 NADLRKLAVNMIPFPRLHFFVAGFAPLIAIGTQKFKTYSVSELTQQMFDSK 297
>TBB_ENCIN (Q9GSR5) Tubulin beta chain (Beta tubulin)| Length = 439 Score = 30.0 bits (66), Expect = 1.5 Identities = 13/51 (25%), Positives = 27/51 (52%) Frame = -3 Query: 344 NPHKERMSISAFHLPKLDMSVGPLSEIVGGGLKKYKTLRVDEVAKVVFSSK 192 N + +++++ P+L V + + G +K+KT V E+ + +F SK Sbjct: 247 NAYLRKLAVNMIPFPRLHFFVVGFAPLTAVGTQKFKTYSVSELTQQMFDSK 297
>SYR_SALTY (P74871) Arginyl-tRNA synthetase (EC 6.1.1.19) (Arginine--tRNA| ligase) (ArgRS) Length = 577 Score = 29.3 bits (64), Expect = 2.5 Identities = 16/60 (26%), Positives = 32/60 (53%), Gaps = 2/60 (3%) Frame = -1 Query: 226 WTRLLRLFSRANLTGRKPRTMPCLASESTRAKAWSRNL--AALVAIIEHIGSKHLPCSTL 53 +TR+L +F +AN+ + + P + SE A+ +R L + ++ G+ H+ C+ L Sbjct: 464 YTRVLSVFRKANIDEQALASAPVIISEDREAQLAARLLQFEETLTVVAREGTPHVMCAYL 523
>RAD50_PYRHO (O58687) DNA double-strand break repair rad50 ATPase| Length = 879 Score = 29.3 bits (64), Expect = 2.5 Identities = 20/59 (33%), Positives = 33/59 (55%), Gaps = 7/59 (11%) Frame = -3 Query: 335 KERMSISAFHLPKLDMSVGPLSEIVGGGLKKYKTL-------RVDEVAKVVFSSKLDGK 180 KER S + L KL++++ + E+ G +K+YK L ++ E+A +FS DGK Sbjct: 704 KERES-AKMELEKLNIAIKRIEEL-RGKIKEYKALIKEEALNKIGEIASEIFSEFTDGK 760
>ENTK_HUMAN (P98073) Enteropeptidase precursor (EC 3.4.21.9) (Enterokinase)| [Contains: Enteropeptidase non-catalytic heavy chain; Enteropeptidase catalytic light chain] Length = 1019 Score = 29.3 bits (64), Expect = 2.5 Identities = 19/53 (35%), Positives = 26/53 (49%) Frame = -1 Query: 304 SQSWI*VWAHYLK*LEEGSRNTRP*GWTRLLRLFSRANLTGRKPRTMPCLASE 146 S W+ AH + RN P WT +L L ++NLT P+T+P L E Sbjct: 816 SSDWLVSAAHCVY-----GRNLEPSKWTAILGLHMKSNLT--SPQTVPRLIDE 861
>TBB_ENCHE (Q24829) Tubulin beta chain (Beta tubulin)| Length = 439 Score = 28.9 bits (63), Expect = 3.3 Identities = 13/51 (25%), Positives = 27/51 (52%) Frame = -3 Query: 344 NPHKERMSISAFHLPKLDMSVGPLSEIVGGGLKKYKTLRVDEVAKVVFSSK 192 N +++++ P+L V + ++ G +K+KT V E+ + +F SK Sbjct: 247 NADLRKLAVNMIPFPRLHFFVVGSAPLIAIGTQKFKTYSVSELTQQMFDSK 297
>NIFJ_SYNY3 (P52965) Putative pyruvate-flavodoxin oxidoreductase (EC 1.2.7.-)| Length = 1199 Score = 28.1 bits (61), Expect = 5.6 Identities = 13/32 (40%), Positives = 18/32 (56%) Frame = +1 Query: 193 LLEKTTLATSSTLRVLYFLSPPPTISDSGPTL 288 ++E A STL LY +S P T+SD P + Sbjct: 597 IVEMNIKAVDSTLAHLYEVSVPETVSDDAPAM 628
>RPA4_YEAST (P46669) DNA-dependent RNA polymerase 36 kDa polypeptide (EC| 2.7.7.6) (A43) Length = 326 Score = 27.7 bits (60), Expect = 7.3 Identities = 12/48 (25%), Positives = 25/48 (52%) Frame = +3 Query: 162 GIVLGFLPVKFARENNLSNLVHPQGLVFLEPSSNYFR*WAHTHIQLWE 305 G+VLG+ +K + LS + L+ + P + + W H ++ +W+ Sbjct: 79 GVVLGYEGLKILDADPLSKEDTSEKLIKITPDTPFGFTWCHVNLYVWQ 126
>RAD50_PYRAB (Q9UZC8) DNA double-strand break repair rad50 ATPase| Length = 880 Score = 27.7 bits (60), Expect = 7.3 Identities = 26/96 (27%), Positives = 41/96 (42%), Gaps = 18/96 (18%) Frame = -3 Query: 335 KERMSISAFHLPKLDMSVGPLSEIVGGGLKKYKTL-------RVDEVAKVVFSSKLDGK- 180 KE + + KL+ ++ + ++ +K YKTL R+ E+A +FS DGK Sbjct: 704 KEEREKAKLEIKKLEKALSKVEDL-RKKIKDYKTLAKEQALNRISEIASEIFSEFTDGKY 762 Query: 179 ----------KTKDYAMLSV*VYKSKSLEQKFSSPG 102 KTK + VY+ K + F S G Sbjct: 763 SNVIVRAEENKTKLFV-----VYEGKEVPLTFLSGG 793
>ENGC_PSESM (Q87VI5) Probable GTPase engC (EC 3.6.1.-)| Length = 343 Score = 27.7 bits (60), Expect = 7.3 Identities = 13/27 (48%), Positives = 16/27 (59%) Frame = -3 Query: 305 LPKLDMSVGPLSEIVGGGLKKYKTLRV 225 LP+ D VGPLSE+ G G T R+ Sbjct: 231 LPETDTRVGPLSEVSGQGTHTTTTARL 257
>SPT6H_DROME (Q9W420) Transcription elongation factor SPT6| Length = 1831 Score = 27.7 bits (60), Expect = 7.3 Identities = 12/24 (50%), Positives = 16/24 (66%) Frame = +1 Query: 214 ATSSTLRVLYFLSPPPTISDSGPT 285 A++S L L+ + PPPTIS S T Sbjct: 1534 ASASNLTPLHLMRPPPTISSSSQT 1557
>PCLO_MOUSE (Q9QYX7) Protein piccolo (Aczonin) (Multidomain presynaptic| cytomatrix protein) (Brain-derived HLMN protein) Length = 5038 Score = 27.3 bits (59), Expect = 9.6 Identities = 11/32 (34%), Positives = 20/32 (62%) Frame = -3 Query: 260 GGGLKKYKTLRVDEVAKVVFSSKLDGKKTKDY 165 GGGL+++KT+ ++ +S++ KKT Y Sbjct: 1566 GGGLRRFKTIELNSTVTDKYSAESSQKKTTLY 1597
>PCLO_HUMAN (Q9Y6V0) Protein piccolo (Aczonin)| Length = 5183 Score = 27.3 bits (59), Expect = 9.6 Identities = 11/32 (34%), Positives = 20/32 (62%) Frame = -3 Query: 260 GGGLKKYKTLRVDEVAKVVFSSKLDGKKTKDY 165 GGGL+++KT+ ++ +S++ KKT Y Sbjct: 1592 GGGLRRFKTIELNSTIADKYSAESSQKKTSLY 1623
>MEF2A_MOUSE (Q60929) Myocyte-specific enhancer factor 2A| Length = 498 Score = 27.3 bits (59), Expect = 9.6 Identities = 14/26 (53%), Positives = 15/26 (57%) Frame = +1 Query: 184 PSSLLEKTTLATSSTLRVLYFLSPPP 261 P S L +LA SSTL LSPPP Sbjct: 157 PGSSLVSPSLAASSTLAETSMLSPPP 182
>PCLO_RAT (Q9JKS6) Protein piccolo (Aczonin) (Multidomain presynaptic| cytomatrix protein) Length = 5085 Score = 27.3 bits (59), Expect = 9.6 Identities = 11/29 (37%), Positives = 19/29 (65%) Frame = -3 Query: 260 GGGLKKYKTLRVDEVAKVVFSSKLDGKKT 174 GGGL+++KT+ ++ +SS+ KKT Sbjct: 1608 GGGLRRFKTIELNSTIADKYSSESSQKKT 1636 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 51,157,057 Number of Sequences: 219361 Number of extensions: 922261 Number of successful extensions: 2412 Number of sequences better than 10.0: 16 Number of HSP's better than 10.0 without gapping: 2390 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2411 length of database: 80,573,946 effective HSP length: 90 effective length of database: 60,831,456 effective search space used: 1459954944 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)