Clone Name | rbart42c11 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | MATK_AMOTI (Q8MED5) Maturase K (Intron maturase) | 29 | 2.9 | 2 | NUSB_CLOTE (Q894G5) N utilization substance protein B homolog (P... | 28 | 4.9 | 3 | OLF11_MOUSE (Q60890) Olfactory receptor 11 (Olfactory receptor 2... | 28 | 6.4 | 4 | MATK_AMOPO (Q8MEE6) Maturase K (Intron maturase) | 28 | 6.4 | 5 | BFR2_SCHPO (Q9US05) Protein bfr2 | 28 | 8.3 |
---|
>MATK_AMOTI (Q8MED5) Maturase K (Intron maturase)| Length = 512 Score = 29.3 bits (64), Expect = 2.9 Identities = 20/75 (26%), Positives = 33/75 (44%) Frame = -1 Query: 225 MRLVVQFFNCFIMLLCSTALFSCH*AIDELPLVLEMIHIYHWWNSN*FLCIIGEITYYYE 46 + ++VQ C+I + L L+ H YH WN+ I + + YY Sbjct: 162 LEILVQILQCWIQ------------DVPSLHLLRFFFHEYHNWNN----LITPKKSNYYG 205 Query: 45 ISVLLPQIYMFLYFS 1 S P++++FLY S Sbjct: 206 FSKENPRLFLFLYNS 220
>NUSB_CLOTE (Q894G5) N utilization substance protein B homolog (Protein nusB)| Length = 153 Score = 28.5 bits (62), Expect = 4.9 Identities = 12/21 (57%), Positives = 14/21 (66%) Frame = +2 Query: 158 QENNAVLQSSIMKQLKNWTTN 220 +EN+ VL I K LKNWT N Sbjct: 74 EENSKVLDEHIEKYLKNWTLN 94
>OLF11_MOUSE (Q60890) Olfactory receptor 11 (Olfactory receptor 256-11) (Odorant| receptor M49) Length = 313 Score = 28.1 bits (61), Expect = 6.4 Identities = 15/47 (31%), Positives = 25/47 (53%) Frame = -3 Query: 208 ILQLFHYAALQHRIILLSLGHR*TSIGAGNDSYLSLVELKLILMYHW 68 I + HY+ + H+ + L L IG GN +LS++ L+L H+ Sbjct: 126 ICRPLHYSVIMHQRLCLQLAAVSWIIGFGNSVWLSILTLQLPRCGHY 172
>MATK_AMOPO (Q8MEE6) Maturase K (Intron maturase)| Length = 512 Score = 28.1 bits (61), Expect = 6.4 Identities = 16/49 (32%), Positives = 25/49 (51%) Frame = -1 Query: 147 IDELPLVLEMIHIYHWWNSN*FLCIIGEITYYYEISVLLPQIYMFLYFS 1 + L L+ H YH WN+ I + + YY S P++++FLY S Sbjct: 176 VPSLHLLRFFFHEYHNWNN----LITPKKSNYYGFSKENPRLFLFLYNS 220
>BFR2_SCHPO (Q9US05) Protein bfr2| Length = 452 Score = 27.7 bits (60), Expect = 8.3 Identities = 9/20 (45%), Positives = 17/20 (85%) Frame = +3 Query: 102 NDKYESFPAPMEVHLWPNDR 161 +DK ++F AP+EV +WP+++ Sbjct: 388 HDKLQNFMAPIEVTVWPDEQ 407 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 35,289,390 Number of Sequences: 219361 Number of extensions: 607125 Number of successful extensions: 1542 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 1535 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1542 length of database: 80,573,946 effective HSP length: 52 effective length of database: 69,167,174 effective search space used: 1660012176 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)