Clone Name | rbart41h07 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | HOMEZ_HUMAN (Q8IX15) Homeobox and leucine zipper protein Homez (... | 28 | 7.7 | 2 | CO8A_MOUSE (Q8K182) Complement component C8 alpha chain precurso... | 28 | 7.7 |
---|
>HOMEZ_HUMAN (Q8IX15) Homeobox and leucine zipper protein Homez (Homeodomain| leucine zipper-containing factor) Length = 525 Score = 28.5 bits (62), Expect = 7.7 Identities = 19/71 (26%), Positives = 28/71 (39%) Frame = +2 Query: 119 ASRAMNQGHAKLNSNCNHGRKVKEFQGKEKKGDGGVHGKSFITGSTSGITPIRSPCMRQF 298 A R NQ H ++ NH V + Q ++K + S S S +TP S F Sbjct: 209 AGRGPNQSHGIGTASWNHSTTVPQPQARDKPPPIALIASSCKEESASSVTPSSSSTSSSF 268 Query: 299 EATPSREKAKS 331 + + A S Sbjct: 269 QVLANGATAAS 279
>CO8A_MOUSE (Q8K182) Complement component C8 alpha chain precursor (Complement| component 8 alpha subunit) Length = 587 Score = 28.5 bits (62), Expect = 7.7 Identities = 15/40 (37%), Positives = 20/40 (50%) Frame = +2 Query: 227 HGKSFITGSTSGITPIRSPCMRQFEATPSREKAKSITGSI 346 +GKS G T G+ P++SP E T S KA S + Sbjct: 242 NGKSHSAGVTVGVAPVKSPV--SIEVTGSGSKASSFLNKL 279 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 49,946,051 Number of Sequences: 219361 Number of extensions: 885315 Number of successful extensions: 2949 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2800 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2944 length of database: 80,573,946 effective HSP length: 102 effective length of database: 58,199,124 effective search space used: 2618960580 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)