Clone Name | rbart41h03 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | POLG_MCFA (P33515) Genome polyprotein [Contains: Capsid protein ... | 29 | 7.1 | 2 | FPG_RHOPA (Q6NDM1) Formamidopyrimidine-DNA glycosylase (EC 3.2.2... | 29 | 9.2 |
---|
>POLG_MCFA (P33515) Genome polyprotein [Contains: Capsid protein C (Core| protein); Envelope protein M (Matrix protein); Major envelope protein E; Nonstructural protein 1 (NS1); Nonstructural protein 2A (NS2A); Flavivirin protease NS2B regulatory subunit; Length = 3341 Score = 29.3 bits (64), Expect = 7.1 Identities = 21/68 (30%), Positives = 39/68 (57%), Gaps = 2/68 (2%) Frame = -3 Query: 334 D*INLAIHVALVVRFLYDAPDQAVDALNKVTVEHQILHRTQIGP*SIVRIV--VSLLNGC 161 D + IH+ALV+ L+ + D+ + +L++ V RT P ++ I+ +++L GC Sbjct: 78 DIVQALIHMALVLHALFASIDRRIRSLSR-RVTALESRRTTGNPMTLAFILGFLTVLCGC 136 Query: 160 VPIDLLIS 137 V ID+ +S Sbjct: 137 VVIDMQVS 144
>FPG_RHOPA (Q6NDM1) Formamidopyrimidine-DNA glycosylase (EC 3.2.2.23)| (Fapy-DNA glycosylase) (DNA-(apurinic or apyrimidinic site) lyase mutM) (EC 4.2.99.18) (AP lyase mutM) Length = 290 Score = 28.9 bits (63), Expect = 9.2 Identities = 13/33 (39%), Positives = 19/33 (57%) Frame = -2 Query: 350 FARIERLNQPCYTCGTSCPFFVRRTRSSR*CPE 252 F +R +PC TCG + FV+ RS+ CP+ Sbjct: 255 FKVYDREGEPCPTCGGTVQRFVQNGRSTFWCPK 287 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 72,075,156 Number of Sequences: 219361 Number of extensions: 1372650 Number of successful extensions: 2721 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2671 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2721 length of database: 80,573,946 effective HSP length: 105 effective length of database: 57,541,041 effective search space used: 4085413911 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)