Clone Name | rbart41g10 |
---|---|
Clone Library Name | barley_pub |
>ASSY_SULAC (Q4J8F1) Argininosuccinate synthase (EC 6.3.4.5)| (Citrulline--aspartate ligase) Length = 391 Score = 28.9 bits (63), Expect = 3.4 Identities = 11/22 (50%), Positives = 16/22 (72%) Frame = +3 Query: 72 NSKELGRRGEFTPMVTDLTSYN 137 N K LGR+G+F+P ++ SYN Sbjct: 340 NMKILGRKGKFSPFSEEIASYN 361
>KAT3_ARATH (P92960) Potassium channel KAT3 (AKT4) (AtKC1) (Potassium channel| TKC) Length = 662 Score = 28.1 bits (61), Expect = 5.7 Identities = 13/38 (34%), Positives = 24/38 (63%) Frame = +2 Query: 2 TEQSSIIEHQNTTLSHNRNGRLSQQQRVGEERRVYTHG 115 T QS+ + + T+S + NG++ +++R G +RV HG Sbjct: 561 TPQSN--DEEIVTVSRHENGQIEERRREGVPKRVIIHG 596
>DNAJ_ACTAC (P77866) Chaperone protein dnaJ| Length = 375 Score = 28.1 bits (61), Expect = 5.7 Identities = 10/30 (33%), Positives = 13/30 (43%) Frame = -2 Query: 140 RIVACQICHHGCKLSSPPQLFAVETACHFC 51 ++ C CH +L F E CHFC Sbjct: 158 KVETCPHCHGAGRLRRQQGFFVTEQPCHFC 187
>NEK1_HUMAN (Q96PY6) Serine/threonine-protein kinase Nek1 (EC 2.7.11.1)| (NimA-related protein kinase 1) (NY-REN-55 antigen) Length = 1258 Score = 27.7 bits (60), Expect = 7.5 Identities = 14/29 (48%), Positives = 17/29 (58%) Frame = -1 Query: 165 EENNKK*LEDCSLSDLSPWV*TLLSSPTL 79 + NN K L CSL DLS TL+ PT+ Sbjct: 1041 DANNPKMLRTCSLPDLSKLFRTLMDVPTV 1069
>NEK1_MOUSE (P51954) Serine/threonine-protein kinase Nek1 (EC 2.7.11.1)| (NimA-related protein kinase 1) Length = 1203 Score = 27.7 bits (60), Expect = 7.5 Identities = 14/29 (48%), Positives = 17/29 (58%) Frame = -1 Query: 165 EENNKK*LEDCSLSDLSPWV*TLLSSPTL 79 + NN K L CSL DLS TL+ PT+ Sbjct: 986 DANNPKMLRTCSLPDLSKLFRTLMDVPTV 1014
>DNAJ_EHRRW (Q5HCG4) Chaperone protein dnaJ| Length = 382 Score = 27.3 bits (59), Expect = 9.8 Identities = 9/28 (32%), Positives = 12/28 (42%) Frame = -2 Query: 134 VACQICHHGCKLSSPPQLFAVETACHFC 51 V C CH + + F +E CH C Sbjct: 166 VQCNTCHGAGNIRTQQGFFTIERTCHVC 193 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 44,994,291 Number of Sequences: 219361 Number of extensions: 727982 Number of successful extensions: 2299 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 2234 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2299 length of database: 80,573,946 effective HSP length: 84 effective length of database: 62,147,622 effective search space used: 1491542928 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)