| Clone Name | rbart41g07 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | KADC_SOLTU (Q8HSW1) Adenylate kinase, chloroplast precursor (EC ... | 72 | 8e-13 | 2 | KADC1_ARATH (Q9ZUU1) Probable adenylate kinase 1, chloroplast pr... | 69 | 9e-12 | 3 | KAD_STRAW (Q82DM5) Adenylate kinase (EC 2.7.4.3) (ATP-AMP transp... | 33 | 0.55 |
|---|
>KADC_SOLTU (Q8HSW1) Adenylate kinase, chloroplast precursor (EC 2.7.4.3)| (ATP-AMP transphosphorylase) Length = 288 Score = 72.0 bits (175), Expect = 8e-13 Identities = 31/52 (59%), Positives = 41/52 (78%) Frame = -3 Query: 496 VYHDLCEPVEDFYRARGKLLEFNLPGGIPGSWPKLLQALNIEDPDNNRSATA 341 +Y D +PVEDFYR++GKLLEF+LPGGIP SWPKLL+ LN+++ + S A Sbjct: 237 IYWDKSQPVEDFYRSQGKLLEFDLPGGIPESWPKLLEVLNLDEQEYKLSPAA 288
>KADC1_ARATH (Q9ZUU1) Probable adenylate kinase 1, chloroplast precursor (EC| 2.7.4.3) (ATP-AMP transphosphorylase) Length = 284 Score = 68.6 bits (166), Expect = 9e-12 Identities = 26/52 (50%), Positives = 42/52 (80%) Frame = -3 Query: 496 VYHDLCEPVEDFYRARGKLLEFNLPGGIPGSWPKLLQALNIEDPDNNRSATA 341 +Y++ +P+E++YR +GKL+EF+LPGGIP SWP+LL+AL ++D + +S A Sbjct: 233 IYNETSQPLEEYYRTKGKLMEFDLPGGIPESWPRLLEALRLDDYEEKQSVAA 284
>KAD_STRAW (Q82DM5) Adenylate kinase (EC 2.7.4.3) (ATP-AMP transphosphorylase)| Length = 220 Score = 32.7 bits (73), Expect = 0.55 Identities = 15/43 (34%), Positives = 24/43 (55%) Frame = -3 Query: 496 VYHDLCEPVEDFYRARGKLLEFNLPGGIPGSWPKLLQALNIED 368 VYH EP+ D+YRA+G ++ + G + + + AL ED Sbjct: 175 VYHTQTEPIIDYYRAQGLVVTISALGPVEEVTQRAMDALKRED 217 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 73,055,034 Number of Sequences: 219361 Number of extensions: 1417752 Number of successful extensions: 3277 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 3213 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3273 length of database: 80,573,946 effective HSP length: 104 effective length of database: 57,760,402 effective search space used: 3523384522 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)