Clone Name | rbart41f10 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | SPA4L_MOUSE (Q9DA32) Sperm-associated antigen 4-like protein | 31 | 1.3 | 2 | O1002_MOUSE (Q8VFK2) Olfactory receptor 1002 (Olfactory receptor... | 29 | 6.6 | 3 | RUMA_RHOGE (Q9JP88) 23S rRNA (uracil-5-)-methyltransferase rumA ... | 28 | 8.6 |
---|
>SPA4L_MOUSE (Q9DA32) Sperm-associated antigen 4-like protein| Length = 348 Score = 31.2 bits (69), Expect = 1.3 Identities = 17/71 (23%), Positives = 33/71 (46%) Frame = -3 Query: 213 PHSVRYLSIIKPILYMRACVVHVVRARTTLLCDESIMYE*YCMVQLLNLFLLCIFMMYMH 34 P ++ +L+ + L + V + R L C + +++ + L +LC+F +M Sbjct: 40 PANMTWLTYLACFLRTQTQQVFLNTCRCKLFCQK--------VMEKMGLLVLCVFGFWMF 91 Query: 33 DMHMNKYVSVW 1 MH+ V VW Sbjct: 92 SMHLPSKVEVW 102
>O1002_MOUSE (Q8VFK2) Olfactory receptor 1002 (Olfactory receptor 175-2)| Length = 318 Score = 28.9 bits (63), Expect = 6.6 Identities = 24/77 (31%), Positives = 36/77 (46%), Gaps = 13/77 (16%) Frame = -3 Query: 201 RYLSIIKPILY-----MRACVVHVVRAR-----TTLLCDESIMYE*YCMVQLLNLF---L 61 RY++I KP+LY R CV V+ +T++ S YC L+N F L Sbjct: 122 RYVAICKPLLYTLIMSQRVCVQLVIGPYSIGLISTVVHTTSAFILPYCGPNLINHFFCDL 181 Query: 60 LCIFMMYMHDMHMNKYV 10 L + + D MNK++ Sbjct: 182 LPVLSLACADTQMNKHL 198
>RUMA_RHOGE (Q9JP88) 23S rRNA (uracil-5-)-methyltransferase rumA (EC 2.1.1.-)| (23S rRNA(M-5-U1939)-methyltransferase) Length = 473 Score = 28.5 bits (62), Expect = 8.6 Identities = 15/35 (42%), Positives = 18/35 (51%) Frame = +1 Query: 340 VRQLVLLRHLWHLGVRHMGLLWHLWHGMVWHFRLR 444 V+Q VL +LWHLG L HG W +R R Sbjct: 97 VKQRVLEDNLWHLGKVKPERLLRPIHGPAWGYRWR 131 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 54,158,319 Number of Sequences: 219361 Number of extensions: 932657 Number of successful extensions: 2007 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 1965 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2007 length of database: 80,573,946 effective HSP length: 102 effective length of database: 58,199,124 effective search space used: 2909956200 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)