Clone Name | rbart41f09 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | GLPT_HAEIN (P96335) Glycerol-3-phosphate transporter (G-3-P tran... | 29 | 6.6 | 2 | L_NDVB (P11205) Large structural protein (Protein L) (Transcript... | 28 | 8.6 | 3 | PCX1_HUMAN (Q96RV3) Pecanex-like protein 1 (Pecanex homolog) | 28 | 8.6 | 4 | PCX1_MOUSE (Q9QYC1) Pecanex-like protein 1 (Pecanex homolog) (Fr... | 28 | 8.6 |
---|
>GLPT_HAEIN (P96335) Glycerol-3-phosphate transporter (G-3-P transporter)| (G-3-P permease) Length = 480 Score = 28.9 bits (63), Expect = 6.6 Identities = 10/33 (30%), Positives = 21/33 (63%) Frame = -1 Query: 426 VYILYVIQSV*LVLISCEQVFIYFESFGIQRWS 328 +++ YV+++ L I+ VF+Y +G+ +WS Sbjct: 257 IFVTYVLKNKLLWYIAIANVFVYLIRYGVLKWS 289
>L_NDVB (P11205) Large structural protein (Protein L) (Transcriptase)| (Replicase) [Includes: RNA-directed RNA polymerase (EC 2.7.7.48); mRNA (guanine-N(7)-)-methyltransferase (EC 2.1.1.56); mRNA guanylyltransferase (EC 2.7.7.-)] Length = 2204 Score = 28.5 bits (62), Expect = 8.6 Identities = 21/64 (32%), Positives = 32/64 (50%), Gaps = 1/64 (1%) Frame = -3 Query: 211 LVI*GLHVQYILFPLILGRREYKLHYLCPKELS*ICLAMYVSNAK-MYLDTSVMYLDKCM 35 LV+ G+ L PL R Y H CPK L + + ++ K M+ DTSV+YL + Sbjct: 2131 LVLKGMISMEDLIPL----RTYLKHSTCPKYLKAV---LGITKLKEMFTDTSVLYLTRAQ 2183 Query: 34 TELF 23 + + Sbjct: 2184 QKFY 2187
>PCX1_HUMAN (Q96RV3) Pecanex-like protein 1 (Pecanex homolog)| Length = 2341 Score = 28.5 bits (62), Expect = 8.6 Identities = 8/19 (42%), Positives = 13/19 (68%) Frame = -2 Query: 452 QSLWSDVWVFTFCMLFSQC 396 Q + D+WVF FC++ + C Sbjct: 1026 QGFFRDIWVFQFCLVIASC 1044
>PCX1_MOUSE (Q9QYC1) Pecanex-like protein 1 (Pecanex homolog) (Fragment)| Length = 1460 Score = 28.5 bits (62), Expect = 8.6 Identities = 8/19 (42%), Positives = 13/19 (68%) Frame = -2 Query: 452 QSLWSDVWVFTFCMLFSQC 396 Q + D+WVF FC++ + C Sbjct: 145 QGFFRDIWVFQFCLVIASC 163 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 64,271,582 Number of Sequences: 219361 Number of extensions: 1183026 Number of successful extensions: 2474 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 2411 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2473 length of database: 80,573,946 effective HSP length: 102 effective length of database: 58,199,124 effective search space used: 2909956200 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)