| Clone Name | rbart41f08 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | HRK1_YEAST (Q08732) Serine/threonine-protein kinase HRK1 (EC 2.7... | 30 | 2.8 | 2 | METX_ZYMMO (Q5NR05) Homoserine O-acetyltransferase (EC 2.3.1.31)... | 29 | 8.2 | 3 | PURL_PYRHO (O59621) Phosphoribosylformylglycinamidine synthase I... | 29 | 8.2 |
|---|
>HRK1_YEAST (Q08732) Serine/threonine-protein kinase HRK1 (EC 2.7.11.1)| (Hygromycin resistance kinase 1) Length = 759 Score = 30.4 bits (67), Expect = 2.8 Identities = 15/41 (36%), Positives = 22/41 (53%), Gaps = 4/41 (9%) Frame = -1 Query: 446 SVKVLAPRRP----RQLARMVVAMQCLGLTVLHPNATATAD 336 +VK PR+P ++ A+ A C+G T+ HPN T D Sbjct: 242 AVKEFRPRKPNESVKEYAKKCTAEFCIGSTLHHPNVIETVD 282
>METX_ZYMMO (Q5NR05) Homoserine O-acetyltransferase (EC 2.3.1.31) (Homoserine| O-trans-acetylase) (Homoserine transacetylase) (HTA) Length = 373 Score = 28.9 bits (63), Expect = 8.2 Identities = 15/41 (36%), Positives = 21/41 (51%), Gaps = 1/41 (2%) Frame = +1 Query: 325 KTSWSAVAVAFGWSTVSPRHCI-ATTILASCLGRRGASTFT 444 K W + + G R+CI + +L SCLG G S+FT Sbjct: 69 KPGWWSRMIGKGKPIDPERYCIICSNVLGSCLGSTGPSSFT 109
>PURL_PYRHO (O59621) Phosphoribosylformylglycinamidine synthase II (EC 6.3.5.3)| (FGAM synthase II) Length = 705 Score = 28.9 bits (63), Expect = 8.2 Identities = 19/70 (27%), Positives = 36/70 (51%) Frame = -1 Query: 476 VEVALAESHASVKVLAPRRPRQLARMVVAMQCLGLTVLHPNATATADQLVFYSFSLRMED 297 VE A +ESH V+ P R + AR + ++ +G ++ N SFS+++ D Sbjct: 635 VEFAFSESHGRYLVVLPERKLEEAREITDLKVIG-RIIGSN-----------SFSVKIND 682 Query: 296 ECRLSSVEEI 267 E L +++++ Sbjct: 683 EVLLWNLDKL 692 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 47,713,631 Number of Sequences: 219361 Number of extensions: 799485 Number of successful extensions: 1617 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 1605 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1617 length of database: 80,573,946 effective HSP length: 104 effective length of database: 57,760,402 effective search space used: 3638905326 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)