Clone Name | rbart41e12 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | NU2M_DUGDU (Q8W9N5) NADH-ubiquinone oxidoreductase chain 2 (EC 1... | 32 | 0.86 | 2 | LY75_MOUSE (Q60767) Lymphocyte antigen 75 precursor (DEC-205) (C... | 30 | 5.6 | 3 | FYV1_MOUSE (Q9Z1T6) FYVE finger-containing phosphoinositide kina... | 30 | 5.6 | 4 | RPM1_CAEEL (Q17551) Ubiquitin ligase protein rpm-1 (EC 6.3.2.-) ... | 29 | 9.5 |
---|
>NU2M_DUGDU (Q8W9N5) NADH-ubiquinone oxidoreductase chain 2 (EC 1.6.5.3) (NADH| dehydrogenase subunit 2) Length = 347 Score = 32.3 bits (72), Expect = 0.86 Identities = 25/83 (30%), Positives = 41/83 (49%), Gaps = 4/83 (4%) Frame = +2 Query: 71 SILLQLHARLTQS-LNTCLRITKFCYHAYTQICIDY---LILLNILTKIQ*RLIIFYIVV 238 SIL+ L Q+ L L + + + I + Y L +LN+L I L IF I++ Sbjct: 161 SILVGGWGGLNQTQLRKILAYSSIAHMGWMLIIMPYNPSLTILNLLIYILMTLSIFMIMM 220 Query: 239 SQHSIAHPSLRKLWNMFDLQMVI 307 + HS + +L LWN + M++ Sbjct: 221 NNHSTSTLTLALLWNKAPMMMIL 243
>LY75_MOUSE (Q60767) Lymphocyte antigen 75 precursor (DEC-205) (CD205 antigen)| Length = 1723 Score = 29.6 bits (65), Expect = 5.6 Identities = 21/68 (30%), Positives = 31/68 (45%) Frame = -3 Query: 516 NSVYAW*QNLMILSRRHVFKLPVNLACSCNKLNKLASWFNLQNQYEELNVLPFIAIFVKK 337 NS Y N MI + RH P + +C KL+ A +++N+ E FV + Sbjct: 1254 NSCY----NFMITNNRHKTVTPEEVQSTCEKLHPKAHSLSIRNEEEN--------TFVVE 1301 Query: 336 YSLHFAYI 313 L+F YI Sbjct: 1302 QLLYFNYI 1309
>FYV1_MOUSE (Q9Z1T6) FYVE finger-containing phosphoinositide kinase (EC 2.7.1.68)| (1-phosphatidylinositol-4-phosphate 5-kinase) (PIP5K) (PtdIns(4)P-5-kinase) (PIKfyve) (p235) Length = 2052 Score = 29.6 bits (65), Expect = 5.6 Identities = 10/31 (32%), Positives = 18/31 (58%) Frame = -3 Query: 357 IAIFVKKYSLHFAYICPITICKSNMFQSLRR 265 + IF+++Y ++Y CP C + M +RR Sbjct: 1209 LGIFLERYCFRYSYQCPSMFCDTPMVHHIRR 1239
>RPM1_CAEEL (Q17551) Ubiquitin ligase protein rpm-1 (EC 6.3.2.-)| (Pam/highwire/rpm-1 protein) (Regulator of presynaptic morphology protein 1) (Synapse defective protein 3) Length = 3766 Score = 28.9 bits (63), Expect = 9.5 Identities = 13/34 (38%), Positives = 22/34 (64%) Frame = +1 Query: 415 LIQFITTACEINRKLEYMSSAENH*ILLPCIYRI 516 ++Q++TT NR EYM SA+ + +LP +R+ Sbjct: 2773 ILQYLTTLTSYNRLAEYMFSAKKNSNILPHPWRL 2806 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 71,409,129 Number of Sequences: 219361 Number of extensions: 1376535 Number of successful extensions: 2564 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 2445 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2564 length of database: 80,573,946 effective HSP length: 105 effective length of database: 57,541,041 effective search space used: 4200495993 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)