Clone Name | rbart41e05 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | PRT1_ARATH (Q8LBL5) Ubiquitin protein ligase PRT1 (EC 6.3.2.-) (... | 28 | 6.0 | 2 | ARX1_SCHPO (O60180) Probable metalloprotease arx1 (EC 3.-.-.-) (... | 28 | 7.9 | 3 | YR865_MIMIV (Q5UP18) Hypothetical protein R865 | 28 | 7.9 |
---|
>PRT1_ARATH (Q8LBL5) Ubiquitin protein ligase PRT1 (EC 6.3.2.-) (Proteolysis 1| protein) Length = 410 Score = 28.1 bits (61), Expect = 6.0 Identities = 18/55 (32%), Positives = 27/55 (49%), Gaps = 1/55 (1%) Frame = +3 Query: 6 HKSCWLKMTQSSNGNNCSKCPLL*APLTYHQHLQNRLHFLIIICYG-AKKARSVQ 167 H SC+ + +S NG S CP+ P + + +L+FL+ Y A K R Q Sbjct: 43 HLSCFWCVHKSMNGFRESHCPICRDPYVHFPSVCQKLYFLLKKMYPLAHKKREEQ 97
>ARX1_SCHPO (O60180) Probable metalloprotease arx1 (EC 3.-.-.-) (Associated| with ribosomal export complex protein 1) Length = 417 Score = 27.7 bits (60), Expect = 7.9 Identities = 11/29 (37%), Positives = 20/29 (68%) Frame = +2 Query: 74 VSSTYIPSASTKSLAFFNNNMLRGKKSSV 160 V+S +P AST+ ++ + +N+L KSS+ Sbjct: 35 VASRCVPGASTREISSYGDNLLHEYKSSI 63
>YR865_MIMIV (Q5UP18) Hypothetical protein R865| Length = 590 Score = 27.7 bits (60), Expect = 7.9 Identities = 18/76 (23%), Positives = 35/76 (46%), Gaps = 5/76 (6%) Frame = -3 Query: 216 RFKSFWLCRHYLSCYHPE-----QTELFLPRSILLLKNASDFVDADGM*VELTIKDI*NN 52 +F +L +++ PE + E+ IL LKN+ F D G +++ ++ N+ Sbjct: 67 KFNKVFLLDYWVESNIPEFNSNLEYEITQAPDILKLKNSEKFKDDKGNIIDIEVRGNKND 126 Query: 51 YSHLMIVSFLTSSFYV 4 +V + S FY+ Sbjct: 127 SECYFLVKDVASGFYI 142 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 38,540,454 Number of Sequences: 219361 Number of extensions: 662495 Number of successful extensions: 1268 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 1256 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1266 length of database: 80,573,946 effective HSP length: 69 effective length of database: 65,438,037 effective search space used: 1570512888 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)