Clone Name | rbart41d05 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | ASC1_LYCES (Q9M6A3) ASC1 protein (Alternaria stem canker resista... | 33 | 0.37 | 2 | NOTC3_HUMAN (Q9UM47) Neurogenic locus notch homolog protein 3 pr... | 29 | 7.1 | 3 | NUON_BUCAI (P57264) NADH-quinone oxidoreductase chain N (EC 1.6.... | 29 | 9.2 |
---|
>ASC1_LYCES (Q9M6A3) ASC1 protein (Alternaria stem canker resistance protein 1)| Length = 308 Score = 33.5 bits (75), Expect = 0.37 Identities = 26/75 (34%), Positives = 36/75 (48%), Gaps = 9/75 (12%) Frame = -1 Query: 279 LSSVVGLDLIS*---SGISLNFSFRSQICI------STCYSVLYVLGLYDVKNVMFARYF 127 +S G DLI+ S +L F+ IC STCY +LYVL + + YF Sbjct: 199 MSKYSGFDLIADIFFSLFALVFTSLRIICYPFWIIRSTCYELLYVLDIQKERTTGIILYF 258 Query: 126 VWMFLSLFLHVAHLY 82 V+ L + L V HL+ Sbjct: 259 VFNALLICLLVLHLF 273
>NOTC3_HUMAN (Q9UM47) Neurogenic locus notch homolog protein 3 precursor (Notch 3)| [Contains: Notch 3 extracellular truncation; Notch 3 intracellular domain] Length = 2321 Score = 29.3 bits (64), Expect = 7.1 Identities = 20/65 (30%), Positives = 27/65 (41%), Gaps = 5/65 (7%) Frame = -2 Query: 476 DLRQALENDLGPGTCRS*SLYNSSNCIC-----RLLCKVTTHQLEECNSPSCFK*PSCVA 312 D+ + L N GPGTC S C C C+ L +C+ SCF +CV Sbjct: 887 DVDECLSNPCGPGTCT--DHVASFTCTCPPGYGGFHCE---QDLPDCSPSSCFNGGTCVD 941 Query: 311 SCYSY 297 S+ Sbjct: 942 GVNSF 946
>NUON_BUCAI (P57264) NADH-quinone oxidoreductase chain N (EC 1.6.99.5) (NADH| dehydrogenase I, chain N) (NDH-1, chain N) Length = 469 Score = 28.9 bits (63), Expect = 9.2 Identities = 21/74 (28%), Positives = 39/74 (52%), Gaps = 3/74 (4%) Frame = -1 Query: 294 WQID*LSSVVGLDLIS*SGISLNFSFRSQICISTCYSV--LYVLGLYDVKNVMFARY-FV 124 W LSSV+ L LIS +GI + F + I + + L+++G + + Y ++ Sbjct: 352 WSHPLLSSVLTLVLISSAGIPMTLGFIGKFYILSIVMIEHLWLIGFAFLIGSLLGLYCYL 411 Query: 123 WMFLSLFLHVAHLY 82 + L+L+LH + L+ Sbjct: 412 RIILNLYLHPSKLF 425 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 71,576,964 Number of Sequences: 219361 Number of extensions: 1378302 Number of successful extensions: 3467 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 3316 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3454 length of database: 80,573,946 effective HSP length: 105 effective length of database: 57,541,041 effective search space used: 4085413911 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)