Clone Name | rbart41a07 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | SRY_MUSSI (Q62565) Sex-determining region Y protein (Testis-dete... | 30 | 2.8 | 2 | ZDH20_MOUSE (Q5Y5T1) Probable palmitoyltransferase ZDHHC20 (EC 2... | 30 | 4.7 | 3 | FILA_MOUSE (P11088) Filaggrin (Fragment) | 29 | 6.2 | 4 | AGL11_ARATH (Q38836) Agamous-like MADS-box protein AGL11 | 29 | 8.1 | 5 | MURI_FUSNN (Q8REE6) Glutamate racemase (EC 5.1.1.3) | 29 | 8.1 |
---|
>SRY_MUSSI (Q62565) Sex-determining region Y protein (Testis-determining| factor) Length = 311 Score = 30.4 bits (67), Expect = 2.8 Identities = 13/53 (24%), Positives = 26/53 (49%) Frame = -1 Query: 500 HHEQDAXXXXEDGHRQDKDEGTKAKLFRRFHQHHHAHDSENEVDEVEELARKL 342 HH+Q D H+Q + + ++FH HHH H + + + ++ ++L Sbjct: 164 HHQQQQQQQFHDHHQQKQQFHDHQQQQQQFHDHHH-HQQQQQFHDHQQQQQQL 215
>ZDH20_MOUSE (Q5Y5T1) Probable palmitoyltransferase ZDHHC20 (EC 2.3.1.-) (Zinc| finger DHHC domain-containing protein 20) (DHHC-20) Length = 380 Score = 29.6 bits (65), Expect = 4.7 Identities = 16/39 (41%), Positives = 20/39 (51%) Frame = -3 Query: 180 CCVRCVTWSALPFPTFIFASYSTLHYHLGLCVSLFVRVG 64 CC R V W + F TF+ +S Y + LCVS R G Sbjct: 9 CCQRVVGWVPVLFITFVVV-WSYYAYVVELCVSTISRTG 46
>FILA_MOUSE (P11088) Filaggrin (Fragment)| Length = 336 Score = 29.3 bits (64), Expect = 6.2 Identities = 13/45 (28%), Positives = 21/45 (46%) Frame = -1 Query: 500 HHEQDAXXXXEDGHRQDKDEGTKAKLFRRFHQHHHAHDSENEVDE 366 H E+++ + GH+ ++ G HQH H H E+E E Sbjct: 157 HSEEESDSQHQHGHQHEQQRG---------HQHQHQHQHEHEQPE 192
>AGL11_ARATH (Q38836) Agamous-like MADS-box protein AGL11| Length = 230 Score = 28.9 bits (63), Expect = 8.1 Identities = 12/31 (38%), Positives = 18/31 (58%) Frame = -1 Query: 437 TKAKLFRRFHQHHHAHDSENEVDEVEELARK 345 TK R+ QHHH S +E++ +E LA + Sbjct: 169 TKVAEVERYQQHHHQMVSGSEINAIEALASR 199
>MURI_FUSNN (Q8REE6) Glutamate racemase (EC 5.1.1.3)| Length = 264 Score = 28.9 bits (63), Expect = 8.1 Identities = 22/59 (37%), Positives = 30/59 (50%), Gaps = 2/59 (3%) Frame = +2 Query: 11 TSDNKTKLLEKH--SCPYNLPTLTNKLTHKPKW*CNVEYEAKIKVGNGRALHVTHRTQQ 181 T DN+ +LL K+ P N TL TH P ++E KIKV + A+ + RT Q Sbjct: 160 TFDNRKELLNKYLSEIPKNADTLVLGCTHYPLIREDIEKNIKIKVVD-PAVEIVERTIQ 217 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 52,327,158 Number of Sequences: 219361 Number of extensions: 921891 Number of successful extensions: 3090 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 2724 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2995 length of database: 80,573,946 effective HSP length: 104 effective length of database: 57,760,402 effective search space used: 3581144924 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)