Clone Name | rbart41a06 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | GLND_RHILO (Q98C27) [Protein-PII] uridylyltransferase (EC 2.7.7.... | 30 | 2.3 | 2 | IF2_ZYMMO (Q5NQ27) Translation initiation factor IF-2 | 30 | 3.0 | 3 | ZN507_HUMAN (Q8TCN5) Zinc finger protein 507 | 29 | 5.1 | 4 | SELV_HUMAN (P59797) Selenoprotein V | 29 | 6.7 | 5 | ICAM5_HUMAN (Q9UMF0) Intercellular adhesion molecule 5 precursor... | 28 | 8.7 |
---|
>GLND_RHILO (Q98C27) [Protein-PII] uridylyltransferase (EC 2.7.7.59) (PII| uridylyl-transferase) (Uridylyl-removing enzyme) (UTase) Length = 933 Score = 30.4 bits (67), Expect = 2.3 Identities = 19/64 (29%), Positives = 28/64 (43%) Frame = -3 Query: 302 EFVKGKSARKEWKARREGLVDLCCSGVGAAAFVGFLVMLTCR*ARAHRLVEGLLTRATNV 123 E + G++ R+E A G GAAA G L +L R A ++ E +L Sbjct: 10 ELIDGEALRREMTALTTATAG---DGSGAAARAGVLQLLKARLAEGRKIAEAMLKEDGGG 66 Query: 122 NTCS 111 N C+ Sbjct: 67 NACA 70
>IF2_ZYMMO (Q5NQ27) Translation initiation factor IF-2| Length = 989 Score = 30.0 bits (66), Expect = 3.0 Identities = 17/50 (34%), Positives = 24/50 (48%) Frame = +1 Query: 142 SKPSTSRCARAQRHVSITRNPTNAAAPTPEQQRSTSPSRLAFHSFRALFP 291 +K + ++ A A TR P AAAP ++RS SP A F + P Sbjct: 292 AKAAQAKTAGAAEGEEKTRRPAKAAAPKAREERSESPRSPAPRRFTPVSP 341
>ZN507_HUMAN (Q8TCN5) Zinc finger protein 507| Length = 849 Score = 29.3 bits (64), Expect = 5.1 Identities = 12/32 (37%), Positives = 20/32 (62%) Frame = +3 Query: 111 RTRIHIRRTCEQTFY*SMRARSAAREHHQEPD 206 +TRI+ + CE++F+ + R+ RE H PD Sbjct: 589 KTRIYQCKQCEESFHYKSQLRNHEREQHSLPD 620
>SELV_HUMAN (P59797) Selenoprotein V| Length = 346 Score = 28.9 bits (63), Expect = 6.7 Identities = 14/37 (37%), Positives = 21/37 (56%) Frame = +1 Query: 133 ARVSKPSTSRCARAQRHVSITRNPTNAAAPTPEQQRS 243 AR PS++R + + R + TR PT PTP + R+ Sbjct: 5 ARTPAPSSARTSTSVRASTPTRTPTPLRTPTPVRTRT 41
>ICAM5_HUMAN (Q9UMF0) Intercellular adhesion molecule 5 precursor (ICAM-5)| (Telencephalin) Length = 924 Score = 28.5 bits (62), Expect = 8.7 Identities = 14/42 (33%), Positives = 18/42 (42%) Frame = +1 Query: 130 VARVSKPSTSRCARAQRHVSITRNPTNAAAPTPEQQRSTSPS 255 + RV P C RH S+ + +A PE ST PS Sbjct: 634 IPRVLAPGIYVCNATNRHGSVAKTVVVSAESPPEMDESTCPS 675 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 37,395,889 Number of Sequences: 219361 Number of extensions: 586515 Number of successful extensions: 2033 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 1927 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2031 length of database: 80,573,946 effective HSP length: 102 effective length of database: 58,199,124 effective search space used: 2968155324 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)