Clone Name | rbart40g09 |
---|---|
Clone Library Name | barley_pub |
>RS3_SPICI (O31161) 30S ribosomal protein S3| Length = 251 Score = 31.2 bits (69), Expect = 0.68 Identities = 20/73 (27%), Positives = 36/73 (49%), Gaps = 4/73 (5%) Frame = +1 Query: 1 KTWHSNWYSVSI*RSENKNEHSFFLQKKCIIQGTKGSS----SIERTKASILLINKNYRM 168 KTW S WY+ + K H +K +++ KG+S IERTK I++ + R+ Sbjct: 15 KTWDSRWYAEK--QEYVKWLHQDIKIRKALMKELKGASVSKIEIERTKKEIVIFIRTARV 72 Query: 169 TTIVNLNQRDYAQ 207 ++ ++ A+ Sbjct: 73 GVVLGQEGKNIAK 85
>MFN1_RAT (Q8R4Z9) Transmembrane GTPase MFN1 (EC 3.6.5.-) (Mitofusin-1)| (Mitochondrial transmembrane GTPase FZO1B) Length = 741 Score = 28.9 bits (63), Expect = 3.4 Identities = 9/21 (42%), Positives = 14/21 (66%) Frame = -1 Query: 95 CIIHFFWRKKECSFLFSDLYI 33 C++H FW K +C+ L DL + Sbjct: 156 CLVHVFWPKAKCALLRDDLVL 176
>MFN1_MOUSE (Q811U4) Transmembrane GTPase MFN1 (EC 3.6.5.-) (Mitofusin-1)| Length = 741 Score = 28.9 bits (63), Expect = 3.4 Identities = 9/21 (42%), Positives = 14/21 (66%) Frame = -1 Query: 95 CIIHFFWRKKECSFLFSDLYI 33 C++H FW K +C+ L DL + Sbjct: 156 CLVHVFWPKAKCALLRDDLVL 176
>SC160_YEAST (P06105) Protein SCP160 (Protein HX)| Length = 1222 Score = 28.1 bits (61), Expect = 5.8 Identities = 20/67 (29%), Positives = 33/67 (49%), Gaps = 2/67 (2%) Frame = +1 Query: 115 SIERTKASILLINK--NYRMTTIVNLNQRDYAQPMDQTTTLFKGTMSSWDLNGPSITQQG 288 SIE +AS+ N+ N T N+ + Y + +LFK + ++W L I++Q Sbjct: 534 SIEEIQASLNKANESLNSLRTKQNNMETKTYEFSEEVQDSLFKPSSATWKLIMEDISEQE 593 Query: 289 GKLRCPL 309 G L+ L Sbjct: 594 GHLQIKL 600
>GLTF_ECOLI (P28721) Protein gltF precursor| Length = 254 Score = 27.7 bits (60), Expect = 7.5 Identities = 21/72 (29%), Positives = 36/72 (50%), Gaps = 2/72 (2%) Frame = +1 Query: 82 KCIIQGTKGSS-SIERTKASILLI-NKNYRMTTIVNLNQRDYAQPMDQTTTLFKGTMSSW 255 K + G K S+ +I T +++ + +K+ R +TIV LN Y + T KGT +++ Sbjct: 72 KLVQLGRKNSTLNITCTAPTLIAVTSKDNRQSTIVALNDTSYIEKAYDTLVDMKGTKNAF 131 Query: 256 DLNGPSITQQGG 291 L Q+ G Sbjct: 132 GLGSAPNGQKIG 143
>TRI63_HUMAN (Q969Q1) Ubiquitin ligase TRIM63 (EC 6.3.2.-) (Tripartite| motif-containing 63) (Muscle-specific RING finger protein 1) (MuRF1) (MURF-1) (RING finger protein 28) (Striated muscle RING zinc finger protein) (Iris RING finger protein) Length = 353 Score = 27.7 bits (60), Expect = 7.5 Identities = 9/26 (34%), Positives = 14/26 (53%) Frame = +1 Query: 229 LFKGTMSSWDLNGPSITQQGGKLRCP 306 +F+ W G S++ GG+ RCP Sbjct: 51 IFQAANPYWTSRGSSVSMSGGRFRCP 76
>VTER_HHV6U (P24443) Probable DNA packaging protein (Terminase)| Length = 667 Score = 27.3 bits (59), Expect = 9.9 Identities = 16/53 (30%), Positives = 25/53 (47%), Gaps = 3/53 (5%) Frame = +1 Query: 61 HSFFLQKKCIIQGTKGSSSIERTKASI---LLINKNYRMTTIVNLNQRDYAQP 210 H FF + K II+G +S + I + NK+ ++T +Q AQP Sbjct: 519 HPFFTEVKIIIEGNSNQASAVKIACIIKENITANKSIQVTFFHTPDQNQIAQP 571
>GCC2_MOUSE (Q8CHG3) GRIP and coiled-coil domain-containing protein 2 (Golgi| coiled coil protein GCC185) Length = 1679 Score = 27.3 bits (59), Expect = 9.9 Identities = 11/43 (25%), Positives = 24/43 (55%) Frame = +1 Query: 91 IQGTKGSSSIERTKASILLINKNYRMTTIVNLNQRDYAQPMDQ 219 +Q K +++T + L+ K+ + TT++N+ DY + M + Sbjct: 1120 LQFQKEKKQLQKTMQELELVKKDAQQTTLMNMEIADYERLMKE 1162
>RBP24_HUMAN (Q4ZG46) Ran-binding protein 2-like 4 (RanBP2L4)| Length = 1583 Score = 27.3 bits (59), Expect = 9.9 Identities = 11/43 (25%), Positives = 24/43 (55%) Frame = +1 Query: 91 IQGTKGSSSIERTKASILLINKNYRMTTIVNLNQRDYAQPMDQ 219 +Q K +++T + L+ K+ + TT++N+ DY + M + Sbjct: 1028 VQLQKQKKQLQKTMQELELVKKDAQQTTLMNMEIADYERLMKE 1070
>GCC2_HUMAN (Q8IWJ2) GRIP and coiled-coil domain-containing protein 2 (Golgi| coiled coil protein GCC185) (CTCL tumor antigen se1-1) (CLL-associated antigen KW-11) (NY-REN-53 antigen) Length = 1583 Score = 27.3 bits (59), Expect = 9.9 Identities = 11/43 (25%), Positives = 24/43 (55%) Frame = +1 Query: 91 IQGTKGSSSIERTKASILLINKNYRMTTIVNLNQRDYAQPMDQ 219 +Q K +++T + L+ K+ + TT++N+ DY + M + Sbjct: 1028 VQLQKEKKQLQKTMQELELVKKDAQQTTLMNMEIADYERLMKE 1070 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 43,083,028 Number of Sequences: 219361 Number of extensions: 722110 Number of successful extensions: 1792 Number of sequences better than 10.0: 10 Number of HSP's better than 10.0 without gapping: 1770 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1792 length of database: 80,573,946 effective HSP length: 82 effective length of database: 62,586,344 effective search space used: 1502072256 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)