Clone Name | rbart40g03 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | ZDH24_HUMAN (Q6UX98) Probable palmitoyltransferase ZDHHC24 (EC 2... | 29 | 6.4 | 2 | CYB_CEPNE (Q34179) Cytochrome b | 29 | 8.3 |
---|
>ZDH24_HUMAN (Q6UX98) Probable palmitoyltransferase ZDHHC24 (EC 2.3.1.-) (Zinc| finger DHHC domain-containing protein 24) (DHHC-24) Length = 284 Score = 29.3 bits (64), Expect = 6.4 Identities = 27/103 (26%), Positives = 42/103 (40%), Gaps = 8/103 (7%) Frame = -3 Query: 306 DPYVRAYFVSG*SSSRGCAMYVT*LRTWSS*QSYVCRSQL--------ASIMCQWRSGSH 151 DP +R ++G +G A Y C+SQ+ A +C R H Sbjct: 76 DPSIRGVMLAGRGLGQGWAY------------CYQCQSQVPPRSGHCSACRVCILRRDHH 123 Query: 150 CQ*CHGVTGFGGCFRLFVFCFLCWLIHALAIYLYTVYVGTPSV 22 C+ GFG +R F LC L+HA + L+ + P++ Sbjct: 124 CRLLGRCVGFGN-YRPF----LCLLLHAAGVLLHVSVLLGPAL 161
>CYB_CEPNE (Q34179) Cytochrome b| Length = 380 Score = 28.9 bits (63), Expect = 8.3 Identities = 11/26 (42%), Positives = 18/26 (69%) Frame = -3 Query: 105 LFVFCFLCWLIHALAIYLYTVYVGTP 28 L+VF LC+L++ L Y+ +Y+ TP Sbjct: 225 LWVFVLLCFLLYVLLCYITLMYLRTP 250 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 60,697,824 Number of Sequences: 219361 Number of extensions: 1094474 Number of successful extensions: 2812 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2740 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2811 length of database: 80,573,946 effective HSP length: 104 effective length of database: 57,760,402 effective search space used: 3696665728 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)