Clone Name | rbart40f04 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | TLR2_CANFA (Q689D1) Toll-like receptor 2 precursor (CD282 antigen) | 30 | 4.3 | 2 | K1849_HUMAN (Q96JH8) Protein KIAA1849 | 29 | 7.3 | 3 | VLPD_MYCHR (Q49536) Variant surface antigen D precursor (VLPD pr... | 28 | 9.6 | 4 | HA22H_ARATH (Q8LEM6) HVA22-like protein h (AtHVA22h) | 28 | 9.6 |
---|
>TLR2_CANFA (Q689D1) Toll-like receptor 2 precursor (CD282 antigen)| Length = 785 Score = 29.6 bits (65), Expect = 4.3 Identities = 14/36 (38%), Positives = 21/36 (58%) Frame = +2 Query: 170 TASSKEQASEQLTSLTGSPSGYCS*AARTRQGSPRG 277 T SKE+A +Q +SL+ P+G C +R+ P G Sbjct: 15 TNLSKEEAPDQSSSLSCDPTGVCDGRSRSLNSMPSG 50
>K1849_HUMAN (Q96JH8) Protein KIAA1849| Length = 1073 Score = 28.9 bits (63), Expect = 7.3 Identities = 15/36 (41%), Positives = 21/36 (58%) Frame = +1 Query: 349 TSSPSRLTQTRTETSRAPISILPAKLMSRLPSSPCP 456 +S P RL +T +ETS +P++ LPA P P P Sbjct: 205 SSPPPRLRRTVSETSLSPVNALPAAAQG--PEEPGP 238
>VLPD_MYCHR (Q49536) Variant surface antigen D precursor (VLPD prolipoprotein)| Length = 168 Score = 28.5 bits (62), Expect = 9.6 Identities = 18/61 (29%), Positives = 31/61 (50%) Frame = +2 Query: 86 QTSTTN*KQEN*TNPSNAMLLFRAGSNSTASSKEQASEQLTSLTGSPSGYCS*AARTRQG 265 Q+ +T+ +E ++ S + + S+ST++SKEQ S TS + S + QG Sbjct: 84 QSDSTSTSKEQGSSDSTSTSKEQGSSDSTSTSKEQGSSDSTSTSKEQGSSDSTSTSKEQG 143 Query: 266 S 268 S Sbjct: 144 S 144
>HA22H_ARATH (Q8LEM6) HVA22-like protein h (AtHVA22h)| Length = 315 Score = 28.5 bits (62), Expect = 9.6 Identities = 14/35 (40%), Positives = 18/35 (51%) Frame = +1 Query: 352 SSPSRLTQTRTETSRAPISILPAKLMSRLPSSPCP 456 SSP + Q +TET A S+ KL + P P P Sbjct: 205 SSPRKQQQLQTETKEAKASVSQTKLTTLTPPGPPP 239 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 49,061,942 Number of Sequences: 219361 Number of extensions: 719252 Number of successful extensions: 2114 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 2071 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2111 length of database: 80,573,946 effective HSP length: 103 effective length of database: 57,979,763 effective search space used: 3246866728 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)