Clone Name | rbart40d06 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | OLFM_RANCA (Q07081) Olfactomedin precursor (Olfactory mucus prot... | 30 | 3.0 | 2 | BAI2_HUMAN (O60241) Brain-specific angiogenesis inhibitor 2 prec... | 30 | 3.9 |
---|
>OLFM_RANCA (Q07081) Olfactomedin precursor (Olfactory mucus protein)| Length = 464 Score = 30.4 bits (67), Expect = 3.0 Identities = 13/33 (39%), Positives = 17/33 (51%) Frame = -1 Query: 227 YICLCTVVNLHFCLFLLASNVAGETRGNLDCLC 129 YICL T+V +H +A N G G C+C Sbjct: 2 YICLLTLVLIHAAAAFVAQNATGILAGKDHCVC 34
>BAI2_HUMAN (O60241) Brain-specific angiogenesis inhibitor 2 precursor| Length = 1572 Score = 30.0 bits (66), Expect = 3.9 Identities = 18/51 (35%), Positives = 28/51 (54%), Gaps = 3/51 (5%) Frame = -1 Query: 212 TVVNLHFCLFLLASNV---AGETRGNLDCLCCKLGEFNHCCHFAKSQFCFV 69 +++ L+FCL +LASN+ G++R +C F H F S FC+V Sbjct: 954 SIILLNFCLSILASNILILVGQSRVLSKGVCTMTAAFLH--FFFLSSFCWV 1002 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 54,535,439 Number of Sequences: 219361 Number of extensions: 878589 Number of successful extensions: 1954 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 1927 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1952 length of database: 80,573,946 effective HSP length: 104 effective length of database: 57,760,402 effective search space used: 3869946934 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)