Clone Name | rbart40c10 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | MPRI_BOVIN (P08169) Cation-independent mannose-6-phosphate recep... | 29 | 5.4 | 2 | SRPR_PSEPU (Q9R9T9) HTH-type transcriptional regulator srpR (Sol... | 28 | 9.2 | 3 | GBRB4_CHICK (P24045) Gamma-aminobutyric-acid receptor beta-4 sub... | 28 | 9.2 |
---|
>MPRI_BOVIN (P08169) Cation-independent mannose-6-phosphate receptor precursor| (CI Man-6-P receptor) (CI-MPR) (M6PR) (Insulin-like growth factor 2 receptor) (Insulin-like growth factor II receptor) (IGF-II receptor) (300 kDa mannose 6-phosphate receptor) Length = 2499 Score = 29.3 bits (64), Expect = 5.4 Identities = 21/74 (28%), Positives = 32/74 (43%), Gaps = 5/74 (6%) Frame = -2 Query: 426 SSNQSRGRRKTKPTHTRNKAATQFSSGDQCAREHAICRNRMEITLHC-----IIAVIITI 262 + +++ GR + PT + +S GD+C I N ITL C A ++T Sbjct: 552 NGSKNLGRFISSPTREKGNIQLSYSDGDECGGGQKIITN---ITLMCKPGDLESAPVLTT 608 Query: 261 SRTKGARIILDGRT 220 SR G + RT Sbjct: 609 SRADGCFYEFEWRT 622
>SRPR_PSEPU (Q9R9T9) HTH-type transcriptional regulator srpR (Solvent efflux| pump srpABC operon corepressor) Length = 213 Score = 28.5 bits (62), Expect = 9.2 Identities = 20/84 (23%), Positives = 36/84 (42%), Gaps = 2/84 (2%) Frame = -3 Query: 389 QLILATRRQPNSVQATNVHESTPSAGI--AWKSHYIAXXXXXXXSAERRVHASYWMAGRD 216 Q +LA+R+ P + + TP GI +W++ +A ++ G D Sbjct: 60 QAVLASRQHPLEL------DFTPDLGIERSWEAVVVAMLDAVHSPQSKQFSEILIYQGLD 113 Query: 215 ESKRMRERMISSAGHFQSCTHTLL 144 ES + RM+ ++ F H +L Sbjct: 114 ESGLIHNRMVQASDRFLQYIHQVL 137
>GBRB4_CHICK (P24045) Gamma-aminobutyric-acid receptor beta-4 subunit precursor| (GABA(A) receptor) Length = 488 Score = 28.5 bits (62), Expect = 9.2 Identities = 21/66 (31%), Positives = 29/66 (43%) Frame = -1 Query: 397 DEANSYSQQGGNPIQFRRPMCTRARHLPESHGNHITLXXXXXXHDQQNEGCTHHIGWQDA 218 D NS G+ IQFR+P+ +R + G+H TL ++ THH A Sbjct: 392 DSRNSVMSFEGSGIQFRKPLASR-----DGFGHHPTL--------DRHVPLTHHAA---A 435 Query: 217 MNRRGC 200 NR C Sbjct: 436 RNRANC 441 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 68,300,356 Number of Sequences: 219361 Number of extensions: 1303164 Number of successful extensions: 2871 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 2816 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2870 length of database: 80,573,946 effective HSP length: 103 effective length of database: 57,979,763 effective search space used: 3130907202 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)