| Clone Name | rbart40b10 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | PODXL_MOUSE (Q9R0M4) Podocalyxin-like protein 1 precursor | 30 | 2.5 | 2 | SYV_ONYPE (Q6YRJ6) Valyl-tRNA synthetase (EC 6.1.1.9) (Valine--t... | 29 | 5.5 | 3 | LASS1_MOUSE (P27545) LAG1 longevity assurance homolog 1 (UOG-1 p... | 29 | 5.5 | 4 | IPNS_STRCT (Q53932) Isopenicillin N synthetase (EC 1.21.3.1) (IP... | 28 | 9.4 |
|---|
>PODXL_MOUSE (Q9R0M4) Podocalyxin-like protein 1 precursor| Length = 503 Score = 30.4 bits (67), Expect = 2.5 Identities = 25/74 (33%), Positives = 35/74 (47%), Gaps = 6/74 (8%) Frame = +1 Query: 220 PLELMALASVSFPWRTLLSDAELYFSSVDDATTKPEPTFQYFPSPA-----QHLP-PLPC 381 P + L +VS L + ++L + D TT P+ PS A QH P +P Sbjct: 137 PTTTLGLINVSSQPTDLNTTSKLLSTPTTDNTTSPQQPVDSSPSTASHPVGQHTPAAVPS 196 Query: 382 TSGSSPSEFDTDTS 423 +SGS+PS TD S Sbjct: 197 SSGSTPS---TDNS 207
>SYV_ONYPE (Q6YRJ6) Valyl-tRNA synthetase (EC 6.1.1.9) (Valine--tRNA ligase)| (ValRS) Length = 882 Score = 29.3 bits (64), Expect = 5.5 Identities = 15/30 (50%), Positives = 19/30 (63%) Frame = +1 Query: 247 VSFPWRTLLSDAELYFSSVDDATTKPEPTF 336 V FP + LSDA L S ++ ATT+PE F Sbjct: 204 VDFPTNSNLSDASLVPSFLEIATTRPETMF 233
>LASS1_MOUSE (P27545) LAG1 longevity assurance homolog 1 (UOG-1 protein)| Length = 350 Score = 29.3 bits (64), Expect = 5.5 Identities = 19/58 (32%), Positives = 26/58 (44%), Gaps = 4/58 (6%) Frame = -2 Query: 303 DGGEVQLGVGEQRSPWEAHGGERHQLQGLAVRLACCGFFSKMFVYGWL----FPVSKL 142 D +VQL + ++A GG H+L GL L C F F + W FP+ L Sbjct: 210 DVSDVQLEFTKLNIYFKARGGAYHRLHGLVANLGCLSF---CFCWFWFRLYWFPLKVL 264
>IPNS_STRCT (Q53932) Isopenicillin N synthetase (EC 1.21.3.1) (IPNS)| (Isopenicillin N synthase) Length = 321 Score = 28.5 bits (62), Expect = 9.4 Identities = 20/69 (28%), Positives = 30/69 (43%), Gaps = 10/69 (14%) Frame = -2 Query: 369 WQVLRRGREVLEGW------LGLGRRVVDGG----EVQLGVGEQRSPWEAHGGERHQLQG 220 + + R GRE +E W G ++ G EV + E+R P GE++ + Sbjct: 90 YYMARPGRETVESWCYLNPSFGEDHPMMKAGTPMHEVNVWPDEERHPDFGSFGEQYHREV 149 Query: 219 LAVRLACCG 193 A R CCG Sbjct: 150 SASRRCCCG 158 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 57,030,670 Number of Sequences: 219361 Number of extensions: 1045024 Number of successful extensions: 3712 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 3411 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3703 length of database: 80,573,946 effective HSP length: 103 effective length of database: 57,979,763 effective search space used: 3188886965 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)