ナショナルバイオリソースプロジェクト
-Barley Genetic Resources Database-
menu 
| Clone Name | rbart40b07 |
|---|---|
| Clone Library Name | barley_pub |
>POLG_HCV6A (Q5I2N3) Genome polyprotein [Contains: Core protein p21 (Capsid| protein C) (p21); Core protein p19; Envelope glycoprotein E1 (gp32) (gp35); Envelope glycoprotein E2 (NS1) (gp68) (gp70); p7; Protease NS2-3 (EC 3.4.22.-) (p23); Serine protease/N Length = 3018 Score = 30.8 bits (68), Expect = 2.4 Identities = 14/32 (43%), Positives = 19/32 (59%) Frame = -3 Query: 275 PRVSGPGKSCGYRRCTQRRGGPAASDLGRRLS 180 P V+ G+SCGYRRC R G + +G L+ Sbjct: 2692 PMVNSKGQSCGYRRC--RASGVLPTSMGNTLT 2721
>BORG5_MOUSE (Q91W92) Cdc42 effector protein 1 (Binder of Rho GTPases 5)| Length = 409 Score = 30.8 bits (68), Expect = 2.4 Identities = 21/77 (27%), Positives = 26/77 (33%) Frame = +3 Query: 222 PLRASAVPTALAWPAHPRRQPRHRSPAHXXXXXXXXXXXXXRVKSGMPKVAGASRYSHGH 401 P + VPTA P + PAH + +P A AS S GH Sbjct: 235 PAAETPVPTANPPAPAANPAPTAKPPAHAITTLDAVTSLPASAVTSLPAPAAASSPSRGH 294 Query: 402 FCVRASSYLGAGGLHSP 452 F +S LG P Sbjct: 295 FPNGVTSVLGPAAEAKP 311
>K0853_HUMAN (Q5T200) Protein KIAA0853| Length = 1668 Score = 30.4 bits (67), Expect = 3.1 Identities = 16/31 (51%), Positives = 19/31 (61%), Gaps = 3/31 (9%) Frame = +3 Query: 216 TPPLRASAVPT---ALAWPAHPRRQPRHRSP 299 TPPLR SA P +L+ P + PRHRSP Sbjct: 364 TPPLRRSASPYPSHSLSSPQRKQSPPRHRSP 394
>ADA11_MOUSE (Q9R1V4) ADAM 11 precursor (A disintegrin and metalloproteinase| domain 11) (Metalloproteinase-like, disintegrin-like, and cysteine-rich protein) (MDC) Length = 773 Score = 30.4 bits (67), Expect = 3.1 Identities = 21/65 (32%), Positives = 29/65 (44%) Frame = -3 Query: 371 HFWHSRFNPEEGSKKGTRRGRAMGR*SVAWLSPRVSGPGKSCGYRRCTQRRGGPAASDLG 192 H RF E+ + +GT RG GR W+ + S CG+ C G P DLG Sbjct: 564 HAAADRFCYEKLNVEGTERGNC-GRKGSGWV--QCSKQDVLCGFLLCVNISGAPRLGDLG 620 Query: 191 RRLSA 177 +S+ Sbjct: 621 GDISS 625
>POLG_HCVT5 (O92529) Genome polyprotein [Contains: Core protein p21 (Capsid| protein C) (p21); Core protein p19; Envelope glycoprotein E1 (gp32) (gp35); Envelope glycoprotein E2 (NS1) (gp68) (gp70); p7; Protease NS2-3 (EC 3.4.22.-) (p23); Serine protease/N Length = 3018 Score = 30.0 bits (66), Expect = 4.0 Identities = 14/32 (43%), Positives = 18/32 (56%) Frame = -3 Query: 275 PRVSGPGKSCGYRRCTQRRGGPAASDLGRRLS 180 P + G+SCGYRRC R G + LG L+ Sbjct: 2692 PMFNSKGESCGYRRC--RASGVLTTSLGNTLT 2721
>POLG_HCVBB (Q68749) Genome polyprotein [Contains: Core protein p21 (Capsid| protein C) (p21); Core protein p19; Envelope glycoprotein E1 (gp32) (gp35); Envelope glycoprotein E2 (NS1) (gp68) (gp70); p7; Protease NS2-3 (EC 3.4.22.-) (p23); Serine protease/N Length = 3036 Score = 29.6 bits (65), Expect = 5.3 Identities = 13/32 (40%), Positives = 18/32 (56%) Frame = -3 Query: 275 PRVSGPGKSCGYRRCTQRRGGPAASDLGRRLS 180 P + G+SCGYRRC R G + +G L+ Sbjct: 2710 PMTNSKGQSCGYRRC--RASGVLTTSMGNTLT 2739
>POLG_HCVVN (O92530) Genome polyprotein [Contains: Core protein p21 (Capsid| protein C) (p21); Core protein p19; Envelope glycoprotein E1 (gp32) (gp35); Envelope glycoprotein E2 (NS1) (gp68) (gp70); p7; Protease NS2-3 (EC 3.4.22.-) (p23); Serine protease/N Length = 3012 Score = 29.6 bits (65), Expect = 5.3 Identities = 14/32 (43%), Positives = 18/32 (56%) Frame = -3 Query: 275 PRVSGPGKSCGYRRCTQRRGGPAASDLGRRLS 180 P + G+SCGYRRC R G + LG L+ Sbjct: 2686 PMYNSRGQSCGYRRC--RASGVLTTSLGNTLT 2715
>CYAA_PODAN (Q01513) Adenylate cyclase (EC 4.6.1.1) (ATP pyrophosphate-lyase)| (Adenylyl cyclase) Length = 2145 Score = 29.3 bits (64), Expect = 6.9 Identities = 16/33 (48%), Positives = 17/33 (51%), Gaps = 1/33 (3%) Frame = -3 Query: 257 GKSCGYRRCTQRRGGPAASDLGR-RLSAPPPTG 162 G S G RR + R GP S LGR P PTG Sbjct: 1738 GSSTGMRRARKARDGPLDSTLGRLDAEVPAPTG 1770
>POLG_HCVEU (O39927) Genome polyprotein [Contains: Core protein p21 (Capsid| protein C) (p21); Core protein p19; Envelope glycoprotein E1 (gp32) (gp35); Envelope glycoprotein E2 (NS1) (gp68) (gp70); p7; Protease NS2-3 (EC 3.4.22.-) (p23); Serine protease/N Length = 3017 Score = 29.3 bits (64), Expect = 6.9 Identities = 13/32 (40%), Positives = 18/32 (56%) Frame = -3 Query: 275 PRVSGPGKSCGYRRCTQRRGGPAASDLGRRLS 180 P + G+SCGYRRC R G + +G L+ Sbjct: 2691 PMANSKGQSCGYRRC--RASGVLPTSMGNTLT 2720
>DAF1_MOUSE (Q61475) Complement decay-accelerating factor, GPI-anchored| precursor (DAF-GPI) (CD55 antigen) Length = 390 Score = 29.3 bits (64), Expect = 6.9 Identities = 17/43 (39%), Positives = 20/43 (46%) Frame = +1 Query: 187 RRPRSLAAGPPRLCVHLRYPQLLPGPLTRGDNHATDHLPMARP 315 R PR+ + PP L L LL P RGD +P ARP Sbjct: 5 RAPRTRPSPPPPLLPLLSLSLLLLSPTVRGDCGPPPDIPNARP 47
>POLG_HCVVA (Q9QAX1) Genome polyprotein [Contains: Core protein p21 (Capsid| protein C) (p21); Core protein p19; Envelope glycoprotein E1 (gp32) (gp35); Envelope glycoprotein E2 (NS1) (gp68) (gp70); p7; Protease NS2-3 (EC 3.4.22.-) (p23); Serine protease/N Length = 3032 Score = 29.3 bits (64), Expect = 6.9 Identities = 12/32 (37%), Positives = 19/32 (59%) Frame = -3 Query: 275 PRVSGPGKSCGYRRCTQRRGGPAASDLGRRLS 180 P ++ G+SCGYRRC R G + +G ++ Sbjct: 2706 PMMNSKGQSCGYRRC--RASGVLTTSMGNTIT 2735
>POLG_HCVJL (Q68798) Genome polyprotein [Contains: Core protein p21 (Capsid| protein C) (p21); Core protein p19; Envelope glycoprotein E1 (gp32) (gp35); Envelope glycoprotein E2 (NS1) (gp68) (gp70); p7; Protease NS2-3 (EC 3.4.22.-) (p23); Serine protease/N Length = 3021 Score = 28.9 bits (63), Expect = 9.0 Identities = 13/32 (40%), Positives = 18/32 (56%) Frame = -3 Query: 275 PRVSGPGKSCGYRRCTQRRGGPAASDLGRRLS 180 P + G+SCGYRRC R G + +G L+ Sbjct: 2695 PMYNSQGQSCGYRRC--RASGVLPTSMGNTLT 2724
>MSBA_BORPA (Q7W9N7) Lipid A export ATP-binding/permease protein msbA| Length = 623 Score = 28.9 bits (63), Expect = 9.0 Identities = 11/29 (37%), Positives = 18/29 (62%) Frame = +3 Query: 366 KVAGASRYSHGHFCVRASSYLGAGGLHSP 452 + AG RY+ GH C++AS L + ++P Sbjct: 13 RAAGGRRYNPGHDCIKASVSLNSAARNAP 41
>MSBA_BORBR (Q7WH20) Lipid A export ATP-binding/permease protein msbA| Length = 623 Score = 28.9 bits (63), Expect = 9.0 Identities = 11/29 (37%), Positives = 18/29 (62%) Frame = +3 Query: 366 KVAGASRYSHGHFCVRASSYLGAGGLHSP 452 + AG RY+ GH C++AS L + ++P Sbjct: 13 RAAGGRRYNPGHDCIKASVSLNSAARNAP 41 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 74,199,364 Number of Sequences: 219361 Number of extensions: 1471052 Number of successful extensions: 3990 Number of sequences better than 10.0: 14 Number of HSP's better than 10.0 without gapping: 3847 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3985 length of database: 80,573,946 effective HSP length: 105 effective length of database: 57,541,041 effective search space used: 3970331829 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)
