| Clone Name | rbart40b03 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | DYR1B_MOUSE (Q9Z188) Dual specificity tyrosine-phosphorylation-r... | 31 | 1.6 | 2 | CHSD_EMENI (P78611) Chitin synthase D (EC 2.4.1.16) (Chitin-UDP ... | 31 | 2.1 | 3 | RENT1_ARATH (Q9FJR0) Regulator of nonsense transcripts 1 homolog... | 30 | 4.6 | 4 | MS3L1_HUMAN (Q8N5Y2) Male-specific lethal 3-like 1 (MSL3-like 1)... | 29 | 6.0 |
|---|
>DYR1B_MOUSE (Q9Z188) Dual specificity tyrosine-phosphorylation-regulated kinase| 1B (EC 2.7.12.1) Length = 589 Score = 31.2 bits (69), Expect = 1.6 Identities = 20/69 (28%), Positives = 31/69 (44%), Gaps = 5/69 (7%) Frame = +3 Query: 72 SQGNHGTTTCTPALLYIQFHCGGE-----EAGRQYPKILLTPPAYYWCGVPSPACIPRAP 236 S G+ G++ A Y +CGG + P++L + P W G P +AP Sbjct: 430 SGGSSGSSNDNRAYRYSNRYCGGPGPPITDCEMNSPQVLPSQPLRPWAGGDVPHKTHQAP 489 Query: 237 ITHLTNPGS 263 I+ T PG+ Sbjct: 490 ISASTLPGT 498
>CHSD_EMENI (P78611) Chitin synthase D (EC 2.4.1.16) (Chitin-UDP| acetyl-glucosaminyl transferase D) (Class-V chitin synthase D) Length = 1184 Score = 30.8 bits (68), Expect = 2.1 Identities = 12/26 (46%), Positives = 15/26 (57%) Frame = +2 Query: 32 RRRKEYSIEITKNQPREPRHHHMHAS 109 RRR+ S ++ N P PRHH H S Sbjct: 25 RRRRRESDSLSNNDPTSPRHHRHHRS 50
>RENT1_ARATH (Q9FJR0) Regulator of nonsense transcripts 1 homolog (EC 3.6.1.-)| (ATP-dependent helicase UPF1) Length = 1254 Score = 29.6 bits (65), Expect = 4.6 Identities = 13/40 (32%), Positives = 21/40 (52%) Frame = +3 Query: 120 IQFHCGGEEAGRQYPKILLTPPAYYWCGVPSPACIPRAPI 239 + F G++ G Y K T A +CG+ +PAC+ R + Sbjct: 117 LNFEETGDDDGFDYGKNDFTEHACKYCGISNPACVVRCNV 156
>MS3L1_HUMAN (Q8N5Y2) Male-specific lethal 3-like 1 (MSL3-like 1) (Male-specific| lethal-3 homolog 1) Length = 521 Score = 29.3 bits (64), Expect = 6.0 Identities = 12/32 (37%), Positives = 18/32 (56%), Gaps = 2/32 (6%) Frame = +2 Query: 41 KEYSIEITKNQPREPRHHHM--HASFTIHTIP 130 K ++I + PRHHH+ HA+ +H IP Sbjct: 215 KHFAINAAFSANERPRHHHVMPHANMNVHYIP 246 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 67,735,258 Number of Sequences: 219361 Number of extensions: 1396969 Number of successful extensions: 3134 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 2997 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3130 length of database: 80,573,946 effective HSP length: 104 effective length of database: 57,760,402 effective search space used: 3465624120 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)