| Clone Name | rbart40a10 |
|---|---|
| Clone Library Name | barley_pub |
>CALX_PEA (O82709) Calnexin homolog precursor| Length = 551 Score = 57.8 bits (138), Expect = 1e-08 Identities = 25/40 (62%), Positives = 33/40 (82%) Frame = -1 Query: 470 KIKIIDLIEKGEKQPNITISILASVAVILVTVLFRTIFGG 351 K KII++IEKGEKQPN+TI I+ SV ++ V++ FR IFGG Sbjct: 463 KEKIIEIIEKGEKQPNLTIGIIVSVVIVFVSIFFRLIFGG 502
>CALX_SOYBN (Q39817) Calnexin homolog precursor| Length = 546 Score = 57.4 bits (137), Expect = 2e-08 Identities = 26/41 (63%), Positives = 32/41 (78%) Frame = -1 Query: 473 YKIKIIDLIEKGEKQPNITISILASVAVILVTVLFRTIFGG 351 +K KI DLIEK EKQPN+TI IL +V V+ V++ FR IFGG Sbjct: 457 HKSKIFDLIEKAEKQPNLTIGILVAVVVVFVSIFFRLIFGG 497
>CALX2_ARATH (Q38798) Calnexin homolog 2 precursor| Length = 532 Score = 53.5 bits (127), Expect = 3e-07 Identities = 24/62 (38%), Positives = 36/62 (58%) Frame = -1 Query: 473 YKIKIIDLIEKGEKQPNITISILASVAVILVTVLFRTIFGGXXXXXXXXXXXXXXXPSAT 294 YK KI++LIEK E QPN+TI +L S+ ++ +++ F+ IFGG S + Sbjct: 450 YKSKIMELIEKAETQPNLTIGVLISIVIVFLSLFFKLIFGGAKAKVEKKKPETAAETSTS 509 Query: 293 EA 288 EA Sbjct: 510 EA 511
>CALX_HELTU (Q39994) Calnexin homolog precursor| Length = 540 Score = 52.0 bits (123), Expect = 8e-07 Identities = 19/41 (46%), Positives = 33/41 (80%) Frame = -1 Query: 473 YKIKIIDLIEKGEKQPNITISILASVAVILVTVLFRTIFGG 351 +K+K+++LIEK E QPNITI ++ S+ V++ ++L + +FGG Sbjct: 451 HKVKVLELIEKAETQPNITIGVIVSIIVVIFSILLKLLFGG 491
>CALX1_ARATH (P29402) Calnexin homolog 1 precursor| Length = 530 Score = 48.9 bits (115), Expect = 7e-06 Identities = 20/41 (48%), Positives = 30/41 (73%) Frame = -1 Query: 473 YKIKIIDLIEKGEKQPNITISILASVAVILVTVLFRTIFGG 351 YK KI +LIEK E+QPN+TI +L ++ V+ ++ + IFGG Sbjct: 448 YKSKITELIEKAEQQPNLTIGVLVAIVVVFFSLFLKLIFGG 488
>SREC2_HUMAN (Q96GP6) Scavenger receptor class F member 2 precursor (Scavenger| receptor expressed by endothelial cells 2 protein) (SREC-II) (SRECRP-1) Length = 866 Score = 31.6 bits (70), Expect = 1.1 Identities = 14/46 (30%), Positives = 20/46 (43%), Gaps = 4/46 (8%) Frame = -3 Query: 408 FGLSCCHPCYCALQNHFRWQEGSGTCEA----RCCGEEAQCHGSRC 283 +G C CYC+ + Q G+ C A R C + C+ S C Sbjct: 177 WGAQCASACYCSATSRCDPQTGACLCHAGWWGRSCNNQCACNSSPC 222
>KRA56_HUMAN (Q6L8G9) Keratin-associated protein 5-6 (Keratin-associated protein| 5.6) (Ultrahigh sulfur keratin-associated protein 5.6) Length = 129 Score = 30.8 bits (68), Expect = 1.9 Identities = 12/28 (42%), Positives = 15/28 (53%) Frame = -3 Query: 399 SCCHPCYCALQNHFRWQEGSGTCEARCC 316 SCC PCYC+ GS C++ CC Sbjct: 89 SCCKPCYCSSGC------GSSCCQSSCC 110
>ZNF77_HUMAN (Q15935) Zinc finger protein 77 (ZNFpT1)| Length = 545 Score = 30.4 bits (67), Expect = 2.5 Identities = 10/32 (31%), Positives = 17/32 (53%) Frame = -3 Query: 384 CYCALQNHFRWQEGSGTCEARCCGEEAQCHGS 289 CY + ++H R G C+ + CG+ C+ S Sbjct: 307 CYSSFRDHVRTHTGEKPCQCKHCGKAFTCYSS 338
>LAMB1_HUMAN (P07942) Laminin beta-1 chain precursor (Laminin B1 chain)| Length = 1786 Score = 28.9 bits (63), Expect = 7.2 Identities = 16/40 (40%), Positives = 17/40 (42%) Frame = -3 Query: 414 FDFGLSCCHPCYCALQNHFRWQEGSGTCEARCCGEEAQCH 295 F FG S C PC C LQ G+ A C QCH Sbjct: 811 FGFGPSGCKPCECHLQ---------GSVNAFCNPVTGQCH 841
>KRA52_HUMAN (Q701N4) Keratin-associated protein 5-2 (Keratin-associated protein| 5.2) (Ultrahigh sulfur keratin-associated protein 5.2) (Keratin-associated protein 5-8) (Keratin-associated protein 5.8) Length = 177 Score = 28.9 bits (63), Expect = 7.2 Identities = 14/39 (35%), Positives = 18/39 (46%) Frame = -3 Query: 399 SCCHPCYCALQNHFRWQEGSGTCEARCCGEEAQCHGSRC 283 SCC PC C+ GS C++ CC + C S C Sbjct: 117 SCCKPCCCSSGC------GSSCCQSSCC-KPCCCQSSCC 148
>KRA54_HUMAN (Q6L8H1) Keratin-associated protein 5-4 (Keratin-associated protein| 5.4) (Ultrahigh sulfur keratin-associated protein 5.4) Length = 288 Score = 28.5 bits (62), Expect = 9.4 Identities = 14/39 (35%), Positives = 18/39 (46%) Frame = -3 Query: 399 SCCHPCYCALQNHFRWQEGSGTCEARCCGEEAQCHGSRC 283 SCC PC C+ GS C++ CC + C S C Sbjct: 200 SCCKPCCCSSGC------GSSCCQSSCC--KPCCSSSGC 230
>ACVR1_BOVIN (Q28041) Activin receptor type-1 precursor (EC 2.7.11.30) (Activin| receptor type I) (ACTR-I) (Serine/threonine-protein kinase receptor R1) (SKR1) Length = 509 Score = 28.5 bits (62), Expect = 9.4 Identities = 9/17 (52%), Positives = 11/17 (64%) Frame = -3 Query: 333 CEARCCGEEAQCHGSRC 283 CE CG+EA C G +C Sbjct: 37 CEGLSCGDEAHCEGQQC 53 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 51,024,570 Number of Sequences: 219361 Number of extensions: 815974 Number of successful extensions: 2512 Number of sequences better than 10.0: 12 Number of HSP's better than 10.0 without gapping: 2373 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2507 length of database: 80,573,946 effective HSP length: 103 effective length of database: 57,979,763 effective search space used: 3188886965 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)