| Clone Name | rbart40a09 |
|---|---|
| Clone Library Name | barley_pub |
>CARB_CAUCR (Q9A4D6) Carbamoyl-phosphate synthase large chain (EC 6.3.5.5)| (Carbamoyl-phosphate synthetase ammonia chain) Length = 1099 Score = 30.8 bits (68), Expect = 2.1 Identities = 15/41 (36%), Positives = 23/41 (56%) Frame = +1 Query: 187 VSIQFSMNDPHSNNMFMLHRVDSKPRLSVPTVNPRVQRKKP 309 +++QF++ +PHS+N PR+ V VNPR R P Sbjct: 838 MNVQFAIEEPHSDN----------PRIYVLEVNPRASRTVP 868
>NOL11_XENLA (Q6INI5) Nucleolar protein 11| Length = 720 Score = 30.4 bits (67), Expect = 2.7 Identities = 19/55 (34%), Positives = 31/55 (56%) Frame = +2 Query: 35 SDPNEYPSSKFVHILVFYNNTVQYSLKLTKYTPLNYFYLFMEKQEKPIQAVSVYS 199 +DP YP S FV ++ NT+ YSL P + LF+EK++ P+ + ++S Sbjct: 443 ADPKFYPQSSFVQLV--QTNTLSYSL-----CP-DLLSLFLEKRDVPLLQLCLHS 489
>EXG_KLULA (Q12628) Glucan 1,3-beta-glucosidase precursor (EC 3.2.1.58)| (Exo-1,3-beta-glucanase) Length = 429 Score = 30.0 bits (66), Expect = 3.6 Identities = 11/31 (35%), Positives = 19/31 (61%) Frame = -1 Query: 464 IILLVSTLIGICLLMNMPLTKDTLLYSNVKI 372 ++ L+S L+ +CL +PL+K Y N K+ Sbjct: 6 VVSLISLLVSVCLAQPLPLSKRYFEYENYKV 36
>BISC_RHOSH (P54934) Biotin sulfoxide reductase (EC 1.-.-.-) (BDS reductase)| (BSO reductase) Length = 744 Score = 29.6 bits (65), Expect = 4.7 Identities = 22/66 (33%), Positives = 27/66 (40%), Gaps = 2/66 (3%) Frame = -3 Query: 441 HWDLPAHEHAAYQGHAPIFKCQN*LVCAAYEFSHDGKEVFNSHAWL--FPLDPGVYSRDT 268 H+++P E QGHAP V H +L F DPG + DT Sbjct: 518 HFEMPDFETFWAQGHAPC-------------------PVQRDHTYLAAFREDPGAHPLDT 558 Query: 267 ESGLAV 250 ESGL V Sbjct: 559 ESGLIV 564
>HEM32_STRCO (Q9KY00) Porphobilinogen deaminase 2 (EC 2.5.1.61) (PBG 2)| (Hydroxymethylbilane synthase 2) (HMBS 2) (Pre-uroporphyrinogen synthase 2) Length = 313 Score = 28.9 bits (63), Expect = 7.9 Identities = 17/48 (35%), Positives = 23/48 (47%) Frame = -3 Query: 432 LPAHEHAAYQGHAPIFKCQN*LVCAAYEFSHDGKEVFNSHAWLFPLDP 289 L H ++ GHA + + L A F+ DGK N+H W LDP Sbjct: 242 LQGHCNSPIAGHAQVDRSGE-LSLRACVFTPDGKVRLNAHEWAGRLDP 288
>SYG_MYCPE (Q8EW64) Glycyl-tRNA synthetase (EC 6.1.1.14) (Glycine--tRNA| ligase) (GlyRS) Length = 462 Score = 28.9 bits (63), Expect = 7.9 Identities = 15/45 (33%), Positives = 21/45 (46%) Frame = +1 Query: 85 LQQYSTIFAEIDKIHSPQLFLFIYGKAREAHTSSVSIQFSMNDPH 219 L+ T + KIH + + Y K AH SS ++ F N PH Sbjct: 239 LESIKTFLFKTLKIHENNIKIIDYPKEELAHYSSRTVDFLYNFPH 283 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 71,314,889 Number of Sequences: 219361 Number of extensions: 1434422 Number of successful extensions: 3602 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 3454 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3599 length of database: 80,573,946 effective HSP length: 104 effective length of database: 57,760,402 effective search space used: 3523384522 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)