| Clone Name | rbart39g09 |
|---|---|
| Clone Library Name | barley_pub |
>TAB3_XENLA (Q7ZXH3) Mitogen-activated protein kinase kinase kinase| 7-interacting protein 3 homolog Length = 692 Score = 30.4 bits (67), Expect = 3.0 Identities = 11/26 (42%), Positives = 18/26 (69%) Frame = +2 Query: 221 RLPFDVLRSPPTSVGSSPFDLPRHRI 298 ++P RSPPTS +SP+ P+H++ Sbjct: 262 QIPQSAFRSPPTSQCTSPYSSPQHQV 287
>SWAP_CAEEL (Q10580) Protein SWAP (Suppressor of white apricot protein homolog)| Length = 749 Score = 29.3 bits (64), Expect = 6.6 Identities = 14/31 (45%), Positives = 17/31 (54%) Frame = +2 Query: 41 ANEIFSLHNQTRRWAERRHRLPCPGDAAQRV 133 A+ IF Q+ AE RH +PC GD RV Sbjct: 24 ASTIFPNDYQSEHIAEERHTVPCLGDPENRV 54
>MURG_MYCTU (O06224) UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide)| pyrophosphoryl-undecaprenol N-acetylglucosamine transferase (EC 2.4.1.227) (Undecaprenyl-PP-MurNAc-pentapeptide-UDPGlcNAc GlcNAc transferase) Length = 410 Score = 28.9 bits (63), Expect = 8.6 Identities = 12/23 (52%), Positives = 16/23 (69%) Frame = +2 Query: 281 LPRHRICGGLPLPPRARQRVRLV 349 LP + GLPLPPR R+R+ +V Sbjct: 140 LPAYLAARGLPLPPRRRRRIPVV 162
>MURG_MYCBO (Q7VEP8) UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide)| pyrophosphoryl-undecaprenol N-acetylglucosamine transferase (EC 2.4.1.227) (Undecaprenyl-PP-MurNAc-pentapeptide-UDPGlcNAc GlcNAc transferase) Length = 410 Score = 28.9 bits (63), Expect = 8.6 Identities = 12/23 (52%), Positives = 16/23 (69%) Frame = +2 Query: 281 LPRHRICGGLPLPPRARQRVRLV 349 LP + GLPLPPR R+R+ +V Sbjct: 140 LPAYLAARGLPLPPRRRRRIPVV 162
>E74EB_DROME (P11536) Ecdysone-induced protein 74EF isoform B (ETS-related| protein E74B) Length = 883 Score = 28.9 bits (63), Expect = 8.6 Identities = 12/26 (46%), Positives = 13/26 (50%) Frame = -3 Query: 149 HPQLHPRAAPHRRGTVAGAAARPIVS 72 HP HP A H T+A AAA S Sbjct: 679 HPHSHPHAGQHTHSTIAAAAAAAAAS 704
>E74EA_DROME (P20105) Ecdysone-induced protein 74EF isoform A (ETS-related| protein E74A) Length = 829 Score = 28.9 bits (63), Expect = 8.6 Identities = 12/26 (46%), Positives = 13/26 (50%) Frame = -3 Query: 149 HPQLHPRAAPHRRGTVAGAAARPIVS 72 HP HP A H T+A AAA S Sbjct: 625 HPHSHPHAGQHTHSTIAAAAAAAAAS 650 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 54,542,579 Number of Sequences: 219361 Number of extensions: 831911 Number of successful extensions: 3452 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 3363 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3452 length of database: 80,573,946 effective HSP length: 104 effective length of database: 57,760,402 effective search space used: 3812186532 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)