Clone Name | rbart39g05 |
---|---|
Clone Library Name | barley_pub |
>AIR12_ARATH (Q94BT2) Auxin-induced in root cultures protein 12 precursor| Length = 252 Score = 42.0 bits (97), Expect = 9e-04 Identities = 16/34 (47%), Positives = 22/34 (64%) Frame = -3 Query: 482 QLPKGMESVNHIWQVGSAVANGVPAKHAFAQENL 381 ++P G +SVN +WQ+G V NG P H F +NL Sbjct: 150 KVPAGADSVNQVWQIGGNVTNGRPGVHPFGPDNL 183
>HRH1_BOVIN (P30546) Histamine H1 receptor| Length = 491 Score = 30.8 bits (68), Expect = 2.0 Identities = 13/29 (44%), Positives = 18/29 (62%) Frame = -2 Query: 93 ASFIISWIPIYIFPVLVYFCLGWNKSDCC 7 A+FII WIP +IF +++ FC CC Sbjct: 426 AAFIICWIPYFIFFMVIAFC-----ESCC 449
>HRH1_PONPY (Q9N2B0) Histamine H1 receptor| Length = 487 Score = 30.4 bits (67), Expect = 2.6 Identities = 12/29 (41%), Positives = 19/29 (65%) Frame = -2 Query: 93 ASFIISWIPIYIFPVLVYFCLGWNKSDCC 7 A+FI+ WIP +IF +++ FC +CC Sbjct: 422 AAFILCWIPYFIFFMVIAFC-----KNCC 445
>HRH1_PANTR (Q9N2B2) Histamine H1 receptor| Length = 487 Score = 30.4 bits (67), Expect = 2.6 Identities = 12/29 (41%), Positives = 19/29 (65%) Frame = -2 Query: 93 ASFIISWIPIYIFPVLVYFCLGWNKSDCC 7 A+FI+ WIP +IF +++ FC +CC Sbjct: 422 AAFILCWIPYFIFFMVIAFC-----KNCC 445
>HRH1_HUMAN (P35367) Histamine H1 receptor| Length = 487 Score = 30.4 bits (67), Expect = 2.6 Identities = 12/29 (41%), Positives = 19/29 (65%) Frame = -2 Query: 93 ASFIISWIPIYIFPVLVYFCLGWNKSDCC 7 A+FI+ WIP +IF +++ FC +CC Sbjct: 422 AAFILCWIPYFIFFMVIAFC-----KNCC 445
>HRH1_GORGO (Q9N2B1) Histamine H1 receptor| Length = 487 Score = 30.4 bits (67), Expect = 2.6 Identities = 12/29 (41%), Positives = 19/29 (65%) Frame = -2 Query: 93 ASFIISWIPIYIFPVLVYFCLGWNKSDCC 7 A+FI+ WIP +IF +++ FC +CC Sbjct: 422 AAFILCWIPYFIFFMVIAFC-----KNCC 445
>HRH1_MOUSE (P70174) Histamine H1 receptor| Length = 488 Score = 30.4 bits (67), Expect = 2.6 Identities = 12/29 (41%), Positives = 19/29 (65%) Frame = -2 Query: 93 ASFIISWIPIYIFPVLVYFCLGWNKSDCC 7 A+FI+ WIP +IF +++ FC + CC Sbjct: 423 AAFILCWIPYFIFFMVIAFC-----NSCC 446
>HRH1_RAT (P31390) Histamine H1 receptor| Length = 486 Score = 30.0 bits (66), Expect = 3.3 Identities = 12/29 (41%), Positives = 18/29 (62%) Frame = -2 Query: 93 ASFIISWIPIYIFPVLVYFCLGWNKSDCC 7 A+FI+ WIP +IF +++ FC CC Sbjct: 421 AAFILCWIPYFIFFMVIAFC-----KSCC 444
>TRMU_BACHD (Q9KDF2) Probable tRNA| (5-methylaminomethyl-2-thiouridylate)-methyltransferase (EC 2.1.1.61) Length = 371 Score = 30.0 bits (66), Expect = 3.3 Identities = 12/29 (41%), Positives = 17/29 (58%) Frame = -2 Query: 246 EEVIAGGSGVHHPRLGSGGHRASRIGWFL 160 + ++ G G HHP L S G RA ++ W L Sbjct: 266 KNILYVGQGFHHPGLYSEGLRAIKVNWIL 294
>MUC2_HUMAN (Q02817) Mucin-2 precursor (Intestinal mucin 2)| Length = 5179 Score = 29.6 bits (65), Expect = 4.4 Identities = 11/24 (45%), Positives = 17/24 (70%) Frame = +2 Query: 218 TPLPPAMTSSHRTAWATTAPPSPC 289 TPLPP++T + ++TT P +PC Sbjct: 1759 TPLPPSITPPTFSPFSTTTPTTPC 1782
>CTND2_HUMAN (Q9UQB3) Catenin delta-2 (Delta-catenin) (Neural| plakophilin-related ARM-repeat protein) (NPRAP) (Neurojungin) (GT24) Length = 1225 Score = 29.3 bits (64), Expect = 5.7 Identities = 13/33 (39%), Positives = 20/33 (60%) Frame = +2 Query: 221 PLPPAMTSSHRTAWATTAPPSPCYQPRRTNHRH 319 PLPPA T ++RT+ A ++P +RT +H Sbjct: 444 PLPPAHTGTYRTSTAPSSPGVDSVPLQRTGSQH 476
>HRH1_CAVPO (P31389) Histamine H1 receptor| Length = 488 Score = 28.9 bits (63), Expect = 7.5 Identities = 9/20 (45%), Positives = 16/20 (80%) Frame = -2 Query: 93 ASFIISWIPIYIFPVLVYFC 34 A+FI+ WIP ++F +++ FC Sbjct: 423 AAFILCWIPYFVFFMVIAFC 442 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 58,063,929 Number of Sequences: 219361 Number of extensions: 1016277 Number of successful extensions: 3642 Number of sequences better than 10.0: 12 Number of HSP's better than 10.0 without gapping: 3498 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3633 length of database: 80,573,946 effective HSP length: 103 effective length of database: 57,979,763 effective search space used: 3304846491 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)