Clone Name | rbart39f08 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | HEM3_NOCFA (Q5YP70) Porphobilinogen deaminase (EC 2.5.1.61) (PBG... | 30 | 4.7 | 2 | PIM1_HUMAN (P11309) Proto-oncogene serine/threonine-protein kina... | 29 | 7.9 |
---|
>HEM3_NOCFA (Q5YP70) Porphobilinogen deaminase (EC 2.5.1.61) (PBG)| (Hydroxymethylbilane synthase) (HMBS) (Pre-uroporphyrinogen synthase) Length = 346 Score = 29.6 bits (65), Expect = 4.7 Identities = 24/58 (41%), Positives = 28/58 (48%), Gaps = 2/58 (3%) Frame = -2 Query: 418 PAQ--LCYECESCRAGLLAALRSQWHKANIALVVATVSLLFLYLIGCSAYKNAHAEAI 251 PAQ L EC S A L+ AL A A VVA +LL GC+A A AE + Sbjct: 196 PAQGALAVECRSEDAALIEALAELDDAATRAAVVAERALLAELEAGCTAPVGALAEVV 253
>PIM1_HUMAN (P11309) Proto-oncogene serine/threonine-protein kinase Pim-1 (EC| 2.7.11.1) Length = 404 Score = 28.9 bits (63), Expect = 7.9 Identities = 17/36 (47%), Positives = 19/36 (52%) Frame = +3 Query: 360 RSAARRPARHDSHS*HSCAGSLLHRPQSGSAAGRAG 467 RS +R R SHS HS SL H P SGS +G Sbjct: 46 RSHSRNATRSHSHS-HSPRHSLRHSPGSGSCGSSSG 80 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 59,263,334 Number of Sequences: 219361 Number of extensions: 1131062 Number of successful extensions: 3280 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 3186 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3279 length of database: 80,573,946 effective HSP length: 104 effective length of database: 57,760,402 effective search space used: 3523384522 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)