Clone Name | rbart39f04 |
---|---|
Clone Library Name | barley_pub |
>RTN3_HUMAN (O95197) Reticulon-3 (Neuroendocrine-specific protein-like 2)| (NSP-like protein II) (NSPLII) Length = 236 Score = 34.3 bits (77), Expect = 0.19 Identities = 20/63 (31%), Positives = 37/63 (58%) Frame = -1 Query: 486 NFLTLFYIVFMVLYTVPVLYEKYEDKIDAFGEKAMVELKKYYAIFDEKCLSKIPKGPSKD 307 N +TL + +++++VP++YEKY+ +ID + A + K EK +K+P G +K Sbjct: 179 NGITLLILAELLIFSVPIVYEKYKTQIDHYVGIARDQTKSIV----EKIQAKLP-GIAKK 233 Query: 306 KKQ 298 K + Sbjct: 234 KAE 236
>RTN3_MOUSE (Q9ES97) Reticulon-3| Length = 237 Score = 33.9 bits (76), Expect = 0.24 Identities = 20/63 (31%), Positives = 37/63 (58%) Frame = -1 Query: 486 NFLTLFYIVFMVLYTVPVLYEKYEDKIDAFGEKAMVELKKYYAIFDEKCLSKIPKGPSKD 307 N +TL + +++++VP++YEKY+ +ID + A + K EK +K+P G +K Sbjct: 180 NGITLLILAELLVFSVPIVYEKYKTQIDHYVGIARDQTKSIV----EKIQAKLP-GIAKK 234 Query: 306 KKQ 298 K + Sbjct: 235 KAE 237
>RTN4_HUMAN (Q9NQC3) Reticulon-4 (Neurite outgrowth inhibitor) (Nogo protein)| (Foocen) (Neuroendocrine-specific protein) (NSP) (Neuroendocrine-specific protein C homolog) (RTN-x) (Reticulon-5) Length = 1192 Score = 32.0 bits (71), Expect = 0.92 Identities = 19/54 (35%), Positives = 31/54 (57%) Frame = -1 Query: 486 NFLTLFYIVFMVLYTVPVLYEKYEDKIDAFGEKAMVELKKYYAIFDEKCLSKIP 325 N LTL + + L++VPV+YE+++ +ID + A +K A K +KIP Sbjct: 1136 NGLTLLILALISLFSVPVIYERHQAQIDHYLGLANKNVKDAMA----KIQAKIP 1185
>TSN4_MOUSE (Q9DCK3) Tetraspanin-4 (Tspan-4) (Transmembrane 4 superfamily| member 7) Length = 238 Score = 31.6 bits (70), Expect = 1.2 Identities = 15/39 (38%), Positives = 25/39 (64%) Frame = -1 Query: 483 FLTLFYIVFMVLYTVPVLYEKYEDKIDAFGEKAMVELKK 367 F L +VF++ T+ VL+ Y DKID++ ++ +LKK Sbjct: 86 FFVLLLLVFLLEATIAVLFFAYSDKIDSYAQQ---DLKK 121
>RTN4_MOUSE (Q99P72) Reticulon-4 (Neurite outgrowth inhibitor) (Nogo protein)| Length = 1162 Score = 31.6 bits (70), Expect = 1.2 Identities = 18/54 (33%), Positives = 31/54 (57%) Frame = -1 Query: 486 NFLTLFYIVFMVLYTVPVLYEKYEDKIDAFGEKAMVELKKYYAIFDEKCLSKIP 325 N LTL + + L+++PV+YE+++ +ID + A +K A K +KIP Sbjct: 1106 NGLTLLILALISLFSIPVIYERHQAQIDHYLGLANKSVKDAMA----KIQAKIP 1155
>ATM_CANGA (Q6FRZ9) Serine/threonine-protein kinase TEL1 (EC 2.7.11.1)| (DNA-damage checkpoint kinase TEL1) (Telomere length regulation protein 1) (ATM homolog) Length = 2763 Score = 31.6 bits (70), Expect = 1.2 Identities = 22/59 (37%), Positives = 31/59 (52%), Gaps = 10/59 (16%) Frame = -1 Query: 474 LFYIVFMVLYTVPV----------LYEKYEDKIDAFGEKAMVELKKYYAIFDEKCLSKI 328 L+YI+ +LY +P LYEKY DK+D EK ++K IFD+ S+I Sbjct: 2269 LWYIMKRLLYKLPFETGYAVINLQLYEKYSDKLD---EKISEKIKAANLIFDQLQNSQI 2324
>RTN4_RAT (Q9JK11) Reticulon-4 (Neurite outgrowth inhibitor) (Nogo protein)| (Foocen) (Glut4 vesicle 20 kDa protein) Length = 1163 Score = 31.2 bits (69), Expect = 1.6 Identities = 18/54 (33%), Positives = 31/54 (57%) Frame = -1 Query: 486 NFLTLFYIVFMVLYTVPVLYEKYEDKIDAFGEKAMVELKKYYAIFDEKCLSKIP 325 N LTL + + L+++PV+YE+++ +ID + A +K A K +KIP Sbjct: 1107 NGLTLLILALISLFSIPVIYERHQVQIDHYLGLANKSVKDAMA----KIQAKIP 1156
>Y1241_AQUAE (O67286) Hypothetical protein aq_1241| Length = 150 Score = 30.4 bits (67), Expect = 2.7 Identities = 18/56 (32%), Positives = 31/56 (55%), Gaps = 4/56 (7%) Frame = -1 Query: 474 LFYIVFMVLYTVPVLYEKYEDKIDAFGEKAMVELKKYYA----IFDEKCLSKIPKG 319 +F ++ +++Y+ L +KY+ G+K + + KK Y I D+K KIPKG Sbjct: 4 IFLLLSLLIYSCQELPKKYQTPE---GKKILEKYKKQYVKGVVILDDKLKEKIPKG 56
>TSN4_HUMAN (O14817) Tetraspanin-4 (Tspan-4) (Transmembrane 4 superfamily| member 7) (Novel antigen 2) (NAG-2) Length = 238 Score = 29.6 bits (65), Expect = 4.6 Identities = 14/39 (35%), Positives = 24/39 (61%) Frame = -1 Query: 483 FLTLFYIVFMVLYTVPVLYEKYEDKIDAFGEKAMVELKK 367 F L +VF++ T+ +L+ Y DKID + ++ +LKK Sbjct: 86 FFLLLLLVFLLEATIAILFFAYTDKIDRYAQQ---DLKK 121
>RTN2_MOUSE (O70622) Reticulon-2 (Neuroendocrine-specific protein-like 1)| (NSP-like protein 1) (NSPLI) Length = 471 Score = 29.3 bits (64), Expect = 6.0 Identities = 12/30 (40%), Positives = 21/30 (70%) Frame = -1 Query: 486 NFLTLFYIVFMVLYTVPVLYEKYEDKIDAF 397 N LTL + + L+TVP+LY +++ +ID + Sbjct: 403 NGLTLVILGVVALFTVPLLYRQHQAQIDQY 432 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 70,221,707 Number of Sequences: 219361 Number of extensions: 1332549 Number of successful extensions: 3738 Number of sequences better than 10.0: 10 Number of HSP's better than 10.0 without gapping: 3657 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3736 length of database: 80,573,946 effective HSP length: 104 effective length of database: 57,760,402 effective search space used: 3465624120 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)