ナショナルバイオリソースプロジェクト
-Barley Genetic Resources Database-
menu 
| Clone Name | rbart39e10 |
|---|---|
| Clone Library Name | barley_pub |
>CYSP1_MAIZE (Q10716) Cysteine proteinase 1 precursor (EC 3.4.22.-)| Length = 371 Score = 125 bits (315), Expect = 4e-29 Identities = 55/62 (88%), Positives = 58/62 (93%) Frame = -2 Query: 469 YGASGFAPSRFKEKPYWIIKNSWGENWGDKGYYKICRGSNVRNKCGVDSMVSTVSATHSS 290 YGASGFAP R K+KPYWIIKNSWGENWG+ GYYKICRGSNVRNKCGVDSMVSTVSA H+S Sbjct: 310 YGASGFAPIRLKDKPYWIIKNSWGENWGENGYYKICRGSNVRNKCGVDSMVSTVSAVHAS 369 Query: 289 KE 284 KE Sbjct: 370 KE 371
>PAPA5_CARPA (P05993) Cysteine proteinase (EC 3.4.22.-) (Clone PLBPC13)| (Fragment) Length = 96 Score = 103 bits (258), Expect = 2e-22 Identities = 44/62 (70%), Positives = 53/62 (85%) Frame = -2 Query: 469 YGASGFAPSRFKEKPYWIIKNSWGENWGDKGYYKICRGSNVRNKCGVDSMVSTVSATHSS 290 YG++G+AP R KEKPYW+IKNSWGENWG+ GYYKICRG RN CGVDSMVSTV+A H++ Sbjct: 38 YGSAGYAPIRLKEKPYWVIKNSWGENWGENGYYKICRG---RNICGVDSMVSTVAAVHTT 94 Query: 289 KE 284 + Sbjct: 95 SQ 96
>RD19A_ARATH (P43296) Cysteine proteinase RD19a precursor (EC 3.4.22.-) (RD19)| Length = 368 Score = 102 bits (253), Expect = 6e-22 Identities = 45/60 (75%), Positives = 53/60 (88%) Frame = -2 Query: 469 YGASGFAPSRFKEKPYWIIKNSWGENWGDKGYYKICRGSNVRNKCGVDSMVSTVSATHSS 290 YGA+G+AP+RFKEKPYWIIKNSWGE WG+ G+YKIC+G RN CGVDSMVSTV+AT S+ Sbjct: 309 YGAAGYAPARFKEKPYWIIKNSWGETWGENGFYKICKG---RNICGVDSMVSTVAATVST 365
>CYSP_PEA (P25804) Cysteine proteinase 15A precursor (EC 3.4.22.-)| (Turgor-responsive protein 15A) Length = 363 Score = 96.3 bits (238), Expect = 4e-20 Identities = 42/60 (70%), Positives = 49/60 (81%) Frame = -2 Query: 469 YGASGFAPSRFKEKPYWIIKNSWGENWGDKGYYKICRGSNVRNKCGVDSMVSTVSATHSS 290 +G +AP R KEKPYWIIKNSWG+NWG++GYYKICRG RN CGVDSMVSTV+A S+ Sbjct: 306 FGKGAYAPIRLKEKPYWIIKNSWGQNWGEQGYYKICRG---RNVCGVDSMVSTVAAAQSN 362
>A494_ARATH (P43295) Probable cysteine proteinase A494 precursor (EC 3.4.22.-)| Length = 361 Score = 94.7 bits (234), Expect = 1e-19 Identities = 41/59 (69%), Positives = 51/59 (86%) Frame = -2 Query: 469 YGASGFAPSRFKEKPYWIIKNSWGENWGDKGYYKICRGSNVRNKCGVDSMVSTVSATHS 293 YG++GF+ +R KEKPYWIIKNSWGE+WG+ G+YKIC+G RN CGVDS+VSTV+AT S Sbjct: 306 YGSAGFSQARLKEKPYWIIKNSWGESWGENGFYKICKG---RNICGVDSLVSTVAATTS 361
>CPR1_DROME (Q9VN93) Putative cysteine proteinase CG12163 precursor (EC| 3.4.22.-) Length = 614 Score = 61.6 bits (148), Expect = 1e-09 Identities = 26/53 (49%), Positives = 35/53 (66%) Frame = -2 Query: 469 YGASGFAPSRFKEKPYWIIKNSWGENWGDKGYYKICRGSNVRNKCGVDSMVST 311 YG S + P+ K PYWI+KNSWG WG++GYY++ RG N CGV M ++ Sbjct: 562 YGVSDY-PNFHKTLPYWIVKNSWGPRWGEQGYYRVYRGDNT---CGVSEMATS 610
>CYSP1_DICDI (P04988) Cysteine proteinase 1 precursor (EC 3.4.22.-)| Length = 343 Score = 56.2 bits (134), Expect = 4e-08 Identities = 23/42 (54%), Positives = 30/42 (71%) Frame = -2 Query: 436 KEKPYWIIKNSWGENWGDKGYYKICRGSNVRNKCGVDSMVST 311 K PYWI+KNSWG +WG++GY + RG +N CGV + VST Sbjct: 302 KNMPYWIVKNSWGADWGEQGYIYLRRG---KNTCGVSNFVST 340
>CATC_SCHMA (Q26563) Cathepsin C precursor (EC 3.4.22.-)| Length = 454 Score = 55.1 bits (131), Expect = 9e-08 Identities = 20/46 (43%), Positives = 33/46 (71%) Frame = -2 Query: 457 GFAPSRFKEKPYWIIKNSWGENWGDKGYYKICRGSNVRNKCGVDSM 320 G+ + +PYW +KNSWG WG++GY++I RG+ ++CGV+S+ Sbjct: 404 GYGVDKLSGEPYWKVKNSWGVEWGEQGYFRILRGT---DECGVESL 446
>CATK_PIG (Q9GLE3) Cathepsin K precursor (EC 3.4.22.38)| Length = 330 Score = 55.1 bits (131), Expect = 9e-08 Identities = 23/41 (56%), Positives = 29/41 (70%) Frame = -2 Query: 436 KEKPYWIIKNSWGENWGDKGYYKICRGSNVRNKCGVDSMVS 314 K K +WIIKNSWGENWG+KGY + R N N CG+ ++ S Sbjct: 288 KGKKHWIIKNSWGENWGNKGYILMARNKN--NACGIANLAS 326
>CATW_FELCA (Q9TST1) Cathepsin W precursor (EC 3.4.22.-)| Length = 374 Score = 55.1 bits (131), Expect = 9e-08 Identities = 23/61 (37%), Positives = 34/61 (55%) Frame = -2 Query: 466 GASGFAPSRFKEKPYWIIKNSWGENWGDKGYYKICRGSNVRNKCGVDSMVSTVSATHSSK 287 GA+G P + P+WI+KNSWG WG GY+++ RG+N CG+ T +K Sbjct: 310 GAAGAQPQSRRSIPFWILKNSWGTKWGXGGYFRLYRGNNT---CGITKYPLTARVDQPAK 366 Query: 286 E 284 + Sbjct: 367 K 367
>CATF_MOUSE (Q9R013) Cathepsin F precursor (EC 3.4.22.41)| Length = 462 Score = 55.1 bits (131), Expect = 9e-08 Identities = 22/39 (56%), Positives = 29/39 (74%) Frame = -2 Query: 427 PYWIIKNSWGENWGDKGYYKICRGSNVRNKCGVDSMVST 311 PYW IKNSWG +WG++GYY + RGS CGV++M S+ Sbjct: 423 PYWAIKNSWGSDWGEEGYYYLYRGSGA---CGVNTMASS 458
>CATW_MOUSE (P56203) Cathepsin W precursor (EC 3.4.22.-) (Lymphopain)| Length = 371 Score = 54.3 bits (129), Expect = 2e-07 Identities = 21/38 (55%), Positives = 28/38 (73%) Frame = -2 Query: 442 RFKEKPYWIIKNSWGENWGDKGYYKICRGSNVRNKCGV 329 R PYWI+KNSWG +WG+KGY+++ RG+N CGV Sbjct: 315 RRHSSPYWILKNSWGAHWGEKGYFRLYRGNNT---CGV 349
>CATF_HUMAN (Q9UBX1) Cathepsin F precursor (EC 3.4.22.41) (CATSF)| Length = 484 Score = 54.3 bits (129), Expect = 2e-07 Identities = 22/39 (56%), Positives = 29/39 (74%) Frame = -2 Query: 427 PYWIIKNSWGENWGDKGYYKICRGSNVRNKCGVDSMVST 311 P+W IKNSWG +WG+KGYY + RGS CGV++M S+ Sbjct: 445 PFWAIKNSWGTDWGEKGYYYLHRGSGA---CGVNTMASS 480
>CATK_RAT (O35186) Cathepsin K precursor (EC 3.4.22.38)| Length = 329 Score = 53.9 bits (128), Expect = 2e-07 Identities = 22/41 (53%), Positives = 28/41 (68%) Frame = -2 Query: 436 KEKPYWIIKNSWGENWGDKGYYKICRGSNVRNKCGVDSMVS 314 K YWIIKNSWGE+WG+KGY + R N N CG+ ++ S Sbjct: 287 KGNKYWIIKNSWGESWGNKGYVLLARNKN--NACGITNLAS 325
>CATW_HUMAN (P56202) Cathepsin W precursor (EC 3.4.22.-) (Lymphopain)| Length = 376 Score = 53.9 bits (128), Expect = 2e-07 Identities = 20/33 (60%), Positives = 26/33 (78%) Frame = -2 Query: 427 PYWIIKNSWGENWGDKGYYKICRGSNVRNKCGV 329 PYWI+KNSWG WG+KGY+++ RGSN CG+ Sbjct: 325 PYWILKNSWGAQWGEKGYFRLHRGSNT---CGI 354
>ALEU_ARATH (Q8H166) Thiol protease aleurain precursor (EC 3.4.22.16) (AtALEU)| (Senescence-associated gene product 2) Length = 358 Score = 53.5 bits (127), Expect = 3e-07 Identities = 21/38 (55%), Positives = 28/38 (73%) Frame = -2 Query: 427 PYWIIKNSWGENWGDKGYYKICRGSNVRNKCGVDSMVS 314 PYW+IKNSWG +WGDKGY+K+ G +N CG+ + S Sbjct: 319 PYWLIKNSWGADWGDKGYFKMEMG---KNMCGIATCAS 353
>CATK_MACMU (P61277) Cathepsin K precursor (EC 3.4.22.38)| Length = 329 Score = 53.1 bits (126), Expect = 3e-07 Identities = 22/41 (53%), Positives = 28/41 (68%) Frame = -2 Query: 436 KEKPYWIIKNSWGENWGDKGYYKICRGSNVRNKCGVDSMVS 314 K +WIIKNSWGENWG+KGY + R N N CG+ ++ S Sbjct: 287 KGNKHWIIKNSWGENWGNKGYILMARNKN--NACGIANLAS 325
>CATK_MACFA (P61276) Cathepsin K precursor (EC 3.4.22.38)| Length = 329 Score = 53.1 bits (126), Expect = 3e-07 Identities = 22/41 (53%), Positives = 28/41 (68%) Frame = -2 Query: 436 KEKPYWIIKNSWGENWGDKGYYKICRGSNVRNKCGVDSMVS 314 K +WIIKNSWGENWG+KGY + R N N CG+ ++ S Sbjct: 287 KGNKHWIIKNSWGENWGNKGYILMARNKN--NACGIANLAS 325
>CATK_HUMAN (P43235) Cathepsin K precursor (EC 3.4.22.38) (Cathepsin O)| (Cathepsin X) (Cathepsin O2) Length = 329 Score = 53.1 bits (126), Expect = 3e-07 Identities = 22/41 (53%), Positives = 28/41 (68%) Frame = -2 Query: 436 KEKPYWIIKNSWGENWGDKGYYKICRGSNVRNKCGVDSMVS 314 K +WIIKNSWGENWG+KGY + R N N CG+ ++ S Sbjct: 287 KGNKHWIIKNSWGENWGNKGYILMARNKN--NACGIANLAS 325
>CATK_MOUSE (P55097) Cathepsin K precursor (EC 3.4.22.38)| Length = 329 Score = 52.8 bits (125), Expect = 4e-07 Identities = 22/41 (53%), Positives = 28/41 (68%) Frame = -2 Query: 436 KEKPYWIIKNSWGENWGDKGYYKICRGSNVRNKCGVDSMVS 314 K +WIIKNSWGE+WG+KGY + R N N CG+ +M S Sbjct: 287 KGSKHWIIKNSWGESWGNKGYALLARNKN--NACGITNMAS 325
>CPR1_CAEEL (P25807) Gut-specific cysteine proteinase precursor (EC 3.4.22.-)| Length = 329 Score = 52.4 bits (124), Expect = 6e-07 Identities = 19/37 (51%), Positives = 28/37 (75%) Frame = -2 Query: 427 PYWIIKNSWGENWGDKGYYKICRGSNVRNKCGVDSMV 317 PYW++ NSWG NWG+ G++KI RG ++CG++S V Sbjct: 289 PYWLVANSWGVNWGESGFFKIYRGD---DQCGIESAV 322
>CYSP_HEMSP (P43156) Thiol protease SEN102 precursor (EC 3.4.22.-)| Length = 360 Score = 52.4 bits (124), Expect = 6e-07 Identities = 23/44 (52%), Positives = 31/44 (70%), Gaps = 1/44 (2%) Frame = -2 Query: 457 GFAPSRFKEKPYWIIKNSWGENWGDKGYYKICRG-SNVRNKCGV 329 G+ +R K YWI+KNSWGE WG+ GY ++ RG S+ R KCG+ Sbjct: 295 GYGATRDGTK-YWIVKNSWGEEWGESGYIRMQRGISDKRGKCGI 337
>CYSP2_MAIZE (Q10717) Cysteine proteinase 2 precursor (EC 3.4.22.-)| Length = 360 Score = 52.4 bits (124), Expect = 6e-07 Identities = 21/38 (55%), Positives = 28/38 (73%) Frame = -2 Query: 427 PYWIIKNSWGENWGDKGYYKICRGSNVRNKCGVDSMVS 314 PYW+IKNSWG +WGD+GY+K+ G +N CGV + S Sbjct: 321 PYWLIKNSWGADWGDEGYFKMEMG---KNMCGVATCAS 355
>CATK_RABIT (P43236) Cathepsin K precursor (EC 3.4.22.38) (OC-2 protein)| Length = 329 Score = 51.2 bits (121), Expect = 1e-06 Identities = 21/41 (51%), Positives = 28/41 (68%) Frame = -2 Query: 436 KEKPYWIIKNSWGENWGDKGYYKICRGSNVRNKCGVDSMVS 314 K +WIIKNSWGE+WG+KGY + R N N CG+ ++ S Sbjct: 287 KGNKHWIIKNSWGESWGNKGYILMARNKN--NACGIANLAS 325
>CPR4_CAEEL (P43508) Cathepsin B-like cysteine proteinase 4 precursor (EC| 3.4.22.-) (Cysteine protease-related 4) Length = 335 Score = 51.2 bits (121), Expect = 1e-06 Identities = 18/37 (48%), Positives = 27/37 (72%) Frame = -2 Query: 427 PYWIIKNSWGENWGDKGYYKICRGSNVRNKCGVDSMV 317 PYW++ NSW NWG+ GY++I RG+ N+CG++ V Sbjct: 295 PYWLVANSWNVNWGENGYFRIIRGT---NECGIEHAV 328
>CYSP_SCHMA (P25792) Cathepsin B-like cysteine proteinase precursor (EC| 3.4.22.-) (Antigen Sm31) Length = 340 Score = 51.2 bits (121), Expect = 1e-06 Identities = 19/37 (51%), Positives = 28/37 (75%) Frame = -2 Query: 427 PYWIIKNSWGENWGDKGYYKICRGSNVRNKCGVDSMV 317 PYW+I NSW E+WG+ GY++I RG R++C ++S V Sbjct: 301 PYWLIANSWNEDWGENGYFRIVRG---RDECSIESEV 334
>CATC_MOUSE (P97821) Dipeptidyl-peptidase 1 precursor (EC 3.4.14.1)| (Dipeptidyl-peptidase I) (DPP-I) (DPPI) (Cathepsin C) (Cathepsin J) (Dipeptidyl transferase) [Contains: Dipeptidyl-peptidase 1 exclusion domain chain (Dipeptidyl-peptidase I exclusion dom Length = 462 Score = 51.2 bits (121), Expect = 1e-06 Identities = 19/35 (54%), Positives = 28/35 (80%) Frame = -2 Query: 424 YWIIKNSWGENWGDKGYYKICRGSNVRNKCGVDSM 320 YWIIKNSWG NWG+ GY++I RG+ ++C ++S+ Sbjct: 421 YWIIKNSWGSNWGESGYFRIRRGT---DECAIESI 452
>LMCPA_LEIME (P25775) Cysteine proteinase A precursor (EC 3.4.22.-)| Length = 354 Score = 50.8 bits (120), Expect = 2e-06 Identities = 17/26 (65%), Positives = 22/26 (84%) Frame = -2 Query: 427 PYWIIKNSWGENWGDKGYYKICRGSN 350 PYWI+KNSWG +WG+KGY ++ GSN Sbjct: 303 PYWIVKNSWGSSWGEKGYIRLAMGSN 328
>CYSP1_LEIPI (P35591) Cysteine proteinase 1 precursor (EC 3.4.22.-) (Amastigote| cysteine proteinase A-1) Length = 354 Score = 50.8 bits (120), Expect = 2e-06 Identities = 17/26 (65%), Positives = 22/26 (84%) Frame = -2 Query: 427 PYWIIKNSWGENWGDKGYYKICRGSN 350 PYWI+KNSWG +WG+KGY ++ GSN Sbjct: 303 PYWIVKNSWGSSWGEKGYIRLAMGSN 328
>CATL_SCHMA (Q26534) Cathepsin L precursor (EC 3.4.22.15) (SMCL1)| Length = 319 Score = 50.8 bits (120), Expect = 2e-06 Identities = 17/42 (40%), Positives = 30/42 (71%) Frame = -2 Query: 436 KEKPYWIIKNSWGENWGDKGYYKICRGSNVRNKCGVDSMVST 311 K +P+WI+KNSWG WG+ GY+++ RG CG++++ ++ Sbjct: 277 KNEPFWIVKNSWGVEWGENGYFRMYRGD---GSCGINTVATS 315
>CATL_CHICK (P09648) Cathepsin L (EC 3.4.22.15) [Contains: Cathepsin L heavy| chain; Cathepsin L light chain] (Fragments) Length = 218 Score = 50.8 bits (120), Expect = 2e-06 Identities = 21/39 (53%), Positives = 26/39 (66%) Frame = -2 Query: 430 KPYWIIKNSWGENWGDKGYYKICRGSNVRNKCGVDSMVS 314 K YWI+KNSWGE WGDKGY I + +N CG+ + S Sbjct: 178 KKYWIVKNSWGEKWGDKGY--IYMAKDRKNHCGIATAAS 214
>CATB_BOVIN (P07688) Cathepsin B precursor (EC 3.4.22.1) [Contains: Cathepsin B| light chain; Cathepsin B heavy chain] Length = 335 Score = 50.4 bits (119), Expect = 2e-06 Identities = 20/45 (44%), Positives = 32/45 (71%), Gaps = 1/45 (2%) Frame = -2 Query: 427 PYWIIKNSWGENWGDKGYYKICRGSNVRNKCGVDS-MVSTVSATH 296 PYW++ NSW +WGD G++KI RG ++ CG++S +V+ + TH Sbjct: 292 PYWLVGNSWNTDWGDNGFFKILRG---QDHCGIESEIVAGMPCTH 333
>CATL_DROME (Q95029) Cathepsin L precursor (EC 3.4.22.15) (Cysteine proteinase| 1) [Contains: Cathepsin L heavy chain; Cathepsin L light chain] Length = 341 Score = 50.4 bits (119), Expect = 2e-06 Identities = 20/37 (54%), Positives = 26/37 (70%) Frame = -2 Query: 424 YWIIKNSWGENWGDKGYYKICRGSNVRNKCGVDSMVS 314 YW++KNSWG WGDKG+ K+ R N N+CG+ S S Sbjct: 303 YWLVKNSWGTTWGDKGFIKMLR--NKENQCGIASASS 337
>CATB3_GIALA (P92133) Cathepsin B-like CP3 precursor (EC 3.4.22.-) (Cathepsin| B-like protease B3) Length = 299 Score = 50.4 bits (119), Expect = 2e-06 Identities = 19/36 (52%), Positives = 27/36 (75%) Frame = -2 Query: 424 YWIIKNSWGENWGDKGYYKICRGSNVRNKCGVDSMV 317 YWIIKNSWG +WG+ GY++I R + N+CG++ V Sbjct: 260 YWIIKNSWGPDWGEDGYFRIIR---MTNECGIEEQV 292
>CYSP7_DICDI (Q94504) Cysteine proteinase 7 precursor (EC 3.4.22.-) (Proteinase| 1) Length = 460 Score = 50.4 bits (119), Expect = 2e-06 Identities = 21/44 (47%), Positives = 30/44 (68%) Frame = -2 Query: 424 YWIIKNSWGENWGDKGYYKICRGSNVRNKCGVDSMVSTVSATHS 293 YWI+KNSWG +WG GY + +G+N N+CG+ +M S +A S Sbjct: 418 YWIVKNSWGTSWGMDGYILMTKGNN--NQCGIATMASRPTAVAS 459
>CATB_RAT (P00787) Cathepsin B precursor (EC 3.4.22.1) (Cathepsin B1) (RSG-2)| [Contains: Cathepsin B light chain; Cathepsin B heavy chain] Length = 339 Score = 50.4 bits (119), Expect = 2e-06 Identities = 18/37 (48%), Positives = 26/37 (70%) Frame = -2 Query: 427 PYWIIKNSWGENWGDKGYYKICRGSNVRNKCGVDSMV 317 PYW++ NSW +WGD G++KI RG N CG++S + Sbjct: 292 PYWLVANSWNVDWGDNGFFKILRG---ENHCGIESEI 325
>ALEUL_ARATH (Q8RWQ9) Thiol protease aleurain-like precursor (EC 3.4.22.16)| Length = 358 Score = 50.4 bits (119), Expect = 2e-06 Identities = 20/33 (60%), Positives = 24/33 (72%) Frame = -2 Query: 427 PYWIIKNSWGENWGDKGYYKICRGSNVRNKCGV 329 PYW+IKNSWG WGD GY+K+ G +N CGV Sbjct: 319 PYWLIKNSWGGEWGDNGYFKMEMG---KNMCGV 348
>CYSP_SCHJA (P43157) Cathepsin B-like cysteine proteinase precursor (EC| 3.4.22.-) (Antigen Sj31) Length = 342 Score = 50.1 bits (118), Expect = 3e-06 Identities = 19/40 (47%), Positives = 29/40 (72%) Frame = -2 Query: 436 KEKPYWIIKNSWGENWGDKGYYKICRGSNVRNKCGVDSMV 317 K PYW+I NSW E+WG+KG +++ RG R++C ++S V Sbjct: 299 KRTPYWLIANSWNEDWGEKGLFRMVRG---RDECSIESDV 335
>CYSP3_OSTOS (Q06544) Cathepsin B-like cysteine proteinase 3 (EC 3.4.22.-)| (Fragment) Length = 174 Score = 50.1 bits (118), Expect = 3e-06 Identities = 19/40 (47%), Positives = 28/40 (70%) Frame = -2 Query: 436 KEKPYWIIKNSWGENWGDKGYYKICRGSNVRNKCGVDSMV 317 K PYW+I NSW ++WG+KG+Y++ RG N C ++ MV Sbjct: 133 KGTPYWLIANSWHDDWGEKGFYRMIRGI---NNCRIEEMV 169
>CATL2_HUMAN (O60911) Cathepsin L2 precursor (EC 3.4.22.43) (Cathepsin V)| (Cathepsin U) Length = 334 Score = 50.1 bits (118), Expect = 3e-06 Identities = 20/48 (41%), Positives = 26/48 (54%) Frame = -2 Query: 457 GFAPSRFKEKPYWIIKNSWGENWGDKGYYKICRGSNVRNKCGVDSMVS 314 GF + YW++KNSWG WG GY KI + N N CG+ + S Sbjct: 285 GFEGANSNNSKYWLVKNSWGPEWGSNGYVKIAKDKN--NHCGIATAAS 330
>CYSP3_LYCES (Q40143) Cysteine proteinase 3 precursor (EC 3.4.22.-)| Length = 356 Score = 50.1 bits (118), Expect = 3e-06 Identities = 20/38 (52%), Positives = 27/38 (71%) Frame = -2 Query: 427 PYWIIKNSWGENWGDKGYYKICRGSNVRNKCGVDSMVS 314 PYW+IKNSWG +WG+ GY+K+ G +N CGV + S Sbjct: 317 PYWLIKNSWGADWGEDGYFKMEMG---KNMCGVATCAS 351
>CYSP3_HOMAM (P25784) Digestive cysteine proteinase 3 precursor (EC 3.4.22.-)| Length = 321 Score = 50.1 bits (118), Expect = 3e-06 Identities = 20/36 (55%), Positives = 25/36 (69%) Frame = -2 Query: 430 KPYWIIKNSWGENWGDKGYYKICRGSNVRNKCGVDS 323 K YW++KNSWG +WGD GY K+ R N N CG+ S Sbjct: 281 KDYWLVKNSWGSSWGDAGYIKMSR--NRDNNCGIAS 314
>CATB_HUMAN (P07858) Cathepsin B precursor (EC 3.4.22.1) (Cathepsin B1) (APP| secretase) (APPS) [Contains: Cathepsin B light chain; Cathepsin B heavy chain] Length = 339 Score = 49.7 bits (117), Expect = 4e-06 Identities = 18/37 (48%), Positives = 27/37 (72%) Frame = -2 Query: 427 PYWIIKNSWGENWGDKGYYKICRGSNVRNKCGVDSMV 317 PYW++ NSW +WGD G++KI RG ++ CG++S V Sbjct: 292 PYWLVANSWNTDWGDNGFFKILRG---QDHCGIESEV 325
>CATO_HUMAN (P43234) Cathepsin O precursor (EC 3.4.22.42)| Length = 321 Score = 49.7 bits (117), Expect = 4e-06 Identities = 20/40 (50%), Positives = 27/40 (67%) Frame = -2 Query: 427 PYWIIKNSWGENWGDKGYYKICRGSNVRNKCGVDSMVSTV 308 PYWI++NSWG +WG GY + GSNV CG+ VS++ Sbjct: 283 PYWIVRNSWGSSWGVDGYAHVKMGSNV---CGIADSVSSI 319
>ACP1_ENTHI (P36184) Cysteine proteinase ACP1 precursor (EC 3.4.22.-)| Length = 308 Score = 49.7 bits (117), Expect = 4e-06 Identities = 19/32 (59%), Positives = 24/32 (75%) Frame = -2 Query: 424 YWIIKNSWGENWGDKGYYKICRGSNVRNKCGV 329 YWII+NSWG +WGD GY+ + R SN N CG+ Sbjct: 266 YWIIRNSWGTSWGDAGYFLLARDSN--NMCGI 295
>CATL_HUMAN (P07711) Cathepsin L precursor (EC 3.4.22.15) (Major excreted| protein) (MEP) [Contains: Cathepsin L heavy chain; Cathepsin L light chain] Length = 333 Score = 49.7 bits (117), Expect = 4e-06 Identities = 21/48 (43%), Positives = 28/48 (58%) Frame = -2 Query: 457 GFAPSRFKEKPYWIIKNSWGENWGDKGYYKICRGSNVRNKCGVDSMVS 314 GF + YW++KNSWGE WG GY K+ + + RN CG+ S S Sbjct: 284 GFESTESDNNKYWLVKNSWGEEWGMGGYVKMAK--DRRNHCGIASAAS 329
>CATH_RAT (P00786) Cathepsin H precursor (EC 3.4.22.16) (Cathepsin B3)| (Cathepsin BA) [Contains: Cathepsin H mini chain; Cathepsin H heavy chain; Cathepsin H light chain] Length = 333 Score = 49.7 bits (117), Expect = 4e-06 Identities = 20/37 (54%), Positives = 26/37 (70%) Frame = -2 Query: 424 YWIIKNSWGENWGDKGYYKICRGSNVRNKCGVDSMVS 314 YWI+KNSWG NWG+ GY+ I RG +N CG+ + S Sbjct: 294 YWIVKNSWGSNWGNNGYFLIERG---KNMCGLAACAS 327
>CATJ_RAT (Q63088) Cathepsin J precursor (EC 3.4.22.-) (Cathepsin P)| (Cathepsin L-related protein) (Catlrp-p) Length = 334 Score = 49.7 bits (117), Expect = 4e-06 Identities = 22/48 (45%), Positives = 27/48 (56%) Frame = -2 Query: 457 GFAPSRFKEKPYWIIKNSWGENWGDKGYYKICRGSNVRNKCGVDSMVS 314 GF + YW+IKNSWGE WG G+ KI + N N CG+ S S Sbjct: 284 GFEGNETDGNNYWLIKNSWGEEWGINGFMKIAKDRN--NHCGIASQAS 329
>ORYB_ORYSA (P25777) Oryzain beta chain precursor (EC 3.4.22.-)| Length = 471 Score = 49.3 bits (116), Expect = 5e-06 Identities = 20/40 (50%), Positives = 26/40 (65%), Gaps = 1/40 (2%) Frame = -2 Query: 430 KPYWIIKNSWGENWGDKGYYKICRGSNV-RNKCGVDSMVS 314 K YWI++NSWG WG+ GY ++ R NV KCG+ M S Sbjct: 314 KDYWIVRNSWGPKWGESGYVRMERNINVTTGKCGIAMMAS 353
>CATJ_MOUSE (Q9R014) Cathepsin J precursor (EC 3.4.22.-) (Cathepsin P)| (Cathepsin L-related protein) (Catlrp-p) Length = 334 Score = 49.3 bits (116), Expect = 5e-06 Identities = 20/37 (54%), Positives = 25/37 (67%) Frame = -2 Query: 424 YWIIKNSWGENWGDKGYYKICRGSNVRNKCGVDSMVS 314 YW+IKNSWGE WG GY +I + N N CG+ S+ S Sbjct: 295 YWLIKNSWGEEWGMNGYMQIAKDHN--NHCGIASLAS 329
>ORYC_ORYSA (P25778) Oryzain gamma chain precursor (EC 3.4.22.-)| Length = 362 Score = 49.3 bits (116), Expect = 5e-06 Identities = 19/38 (50%), Positives = 26/38 (68%) Frame = -2 Query: 427 PYWIIKNSWGENWGDKGYYKICRGSNVRNKCGVDSMVS 314 PYW+IKNSWG +WGD GY+ + G +N CG+ + S Sbjct: 323 PYWLIKNSWGADWGDNGYFTMEMG---KNMCGIATCAS 357
>ALEU_HORVU (P05167) Thiol protease aleurain precursor (EC 3.4.22.16)| Length = 362 Score = 49.3 bits (116), Expect = 5e-06 Identities = 17/27 (62%), Positives = 22/27 (81%) Frame = -2 Query: 427 PYWIIKNSWGENWGDKGYYKICRGSNV 347 PYW+IKNSWG +WGD GY+K+ G N+ Sbjct: 322 PYWLIKNSWGADWGDNGYFKMEMGKNM 348
>CATS_MOUSE (O70370) Cathepsin S precursor (EC 3.4.22.27)| Length = 340 Score = 48.9 bits (115), Expect = 6e-06 Identities = 20/39 (51%), Positives = 28/39 (71%) Frame = -2 Query: 430 KPYWIIKNSWGENWGDKGYYKICRGSNVRNKCGVDSMVS 314 K YW++KNSWG N+GD+GY ++ R N +N CG+ S S Sbjct: 300 KDYWLVKNSWGLNFGDQGYIRMAR--NNKNHCGIASYCS 336
>CATC_CANFA (O97578) Dipeptidyl-peptidase 1 precursor (EC 3.4.14.1)| (Dipeptidyl-peptidase I) (DPP-I) (DPPI) (Cathepsin C) (Cathepsin J) (Dipeptidyl transferase) [Contains: Dipeptidyl-peptidase 1 exclusion domain chain (Dipeptidyl-peptidase I exclusion dom Length = 435 Score = 48.9 bits (115), Expect = 6e-06 Identities = 21/53 (39%), Positives = 33/53 (62%) Frame = -2 Query: 457 GFAPSRFKEKPYWIIKNSWGENWGDKGYYKICRGSNVRNKCGVDSMVSTVSAT 299 G+ YWI+KNSWG WG+ GY++I RG+ ++C ++S+ V+AT Sbjct: 383 GYGTDSASGMDYWIVKNSWGSRWGEDGYFRIRRGT---DECAIESI--AVAAT 430
>CATL_SARPE (Q26636) Cathepsin L precursor (EC 3.4.22.15) [Contains: Cathepsin| L heavy chain; Cathepsin L light chain] Length = 339 Score = 48.9 bits (115), Expect = 6e-06 Identities = 17/32 (53%), Positives = 24/32 (75%) Frame = -2 Query: 424 YWIIKNSWGENWGDKGYYKICRGSNVRNKCGV 329 YW++KNSWG WG++GY K+ R N N+CG+ Sbjct: 301 YWLVKNSWGTTWGEQGYIKMARNQN--NQCGI 330
>CATC_MACFA (Q60HG6) Dipeptidyl-peptidase 1 precursor (EC 3.4.14.1)| (Dipeptidyl-peptidase I) (DPP-I) (DPPI) (Cathepsin C) (Cathepsin J) (Dipeptidyl transferase) [Contains: Dipeptidyl-peptidase 1 exclusion domain chain (Dipeptidyl-peptidase I exclusion dom Length = 463 Score = 48.9 bits (115), Expect = 6e-06 Identities = 21/53 (39%), Positives = 34/53 (64%) Frame = -2 Query: 457 GFAPSRFKEKPYWIIKNSWGENWGDKGYYKICRGSNVRNKCGVDSMVSTVSAT 299 G+ YWI+KNSWG +WG+ GY++I RG+ ++C ++S+ V+AT Sbjct: 411 GYGTDSASGMDYWIVKNSWGTSWGEDGYFRIRRGT---DECAIESI--AVAAT 458
>CATC_HUMAN (P53634) Dipeptidyl-peptidase 1 precursor (EC 3.4.14.1)| (Dipeptidyl-peptidase I) (DPP-I) (DPPI) (Cathepsin C) (Cathepsin J) (Dipeptidyl transferase) [Contains: Dipeptidyl-peptidase 1 exclusion domain chain (Dipeptidyl-peptidase I exclusion dom Length = 463 Score = 48.9 bits (115), Expect = 6e-06 Identities = 21/53 (39%), Positives = 33/53 (62%) Frame = -2 Query: 457 GFAPSRFKEKPYWIIKNSWGENWGDKGYYKICRGSNVRNKCGVDSMVSTVSAT 299 G+ YWI+KNSWG WG+ GY++I RG+ ++C ++S+ V+AT Sbjct: 411 GYGTDSASGMDYWIVKNSWGTGWGENGYFRIRRGT---DECAIESI--AVAAT 458
>CATB1_GIALA (P92131) Cathepsin B-like CP1 precursor (EC 3.4.22.-) (Cathepsin| B-like protease B1) Length = 303 Score = 48.9 bits (115), Expect = 6e-06 Identities = 19/39 (48%), Positives = 27/39 (69%) Frame = -2 Query: 424 YWIIKNSWGENWGDKGYYKICRGSNVRNKCGVDSMVSTV 308 YWIIKNSWG +WG+ GY++I RG N+C ++ + V Sbjct: 265 YWIIKNSWGPDWGENGYFRIVRGV---NECRIEDEIYAV 300
>CYSP_THEAN (P25781) Cysteine proteinase precursor (EC 3.4.22.-)| Length = 441 Score = 48.5 bits (114), Expect = 8e-06 Identities = 17/32 (53%), Positives = 24/32 (75%) Frame = -2 Query: 424 YWIIKNSWGENWGDKGYYKICRGSNVRNKCGV 329 YWIIKNSWGE+WG+ G+ ++ R +KCG+ Sbjct: 398 YWIIKNSWGEDWGENGFLRLQRTKKGLDKCGI 429
>CPGP2_ZINOF (P82474) Cysteine proteinase GP-II (EC 3.4.22.-)| Length = 221 Score = 48.5 bits (114), Expect = 8e-06 Identities = 19/41 (46%), Positives = 26/41 (63%), Gaps = 1/41 (2%) Frame = -2 Query: 433 EKPYWIIKNSWGENWGDKGYYKICRG-SNVRNKCGVDSMVS 314 +K +WI+KNSWG+NWG+ GY + R N KCG+ S Sbjct: 173 DKDFWIVKNSWGKNWGESGYIRAERNIENPDGKCGITRFAS 213
>CATV_GVCP (O91466) Viral cathepsin (EC 3.4.22.50) (V-cath) (Cysteine| proteinase) (CP) Length = 333 Score = 48.5 bits (114), Expect = 8e-06 Identities = 17/33 (51%), Positives = 25/33 (75%) Frame = -2 Query: 427 PYWIIKNSWGENWGDKGYYKICRGSNVRNKCGV 329 PYWI+KNSWG WG++GY+++ R +N CG+ Sbjct: 294 PYWILKNSWGAEWGEEGYFRVQRD---KNSCGM 323
>CATLL_FASHE (Q24940) Cathepsin L-like proteinase precursor (EC 3.4.22.-)| Length = 326 Score = 48.5 bits (114), Expect = 8e-06 Identities = 19/37 (51%), Positives = 26/37 (70%) Frame = -2 Query: 424 YWIIKNSWGENWGDKGYYKICRGSNVRNKCGVDSMVS 314 YWI+KNSWG WG++GY ++ R N N CG+ S+ S Sbjct: 284 YWIVKNSWGTYWGERGYIRMAR--NRGNMCGIASLAS 318
>CATC_RAT (P80067) Dipeptidyl-peptidase 1 precursor (EC 3.4.14.1)| (Dipeptidyl-peptidase I) (DPP-I) (DPPI) (Cathepsin C) (Cathepsin J) (Dipeptidyl transferase) [Contains: Dipeptidyl-peptidase 1 exclusion domain chain (Dipeptidyl-peptidase I exclusion domai Length = 462 Score = 48.5 bits (114), Expect = 8e-06 Identities = 17/35 (48%), Positives = 27/35 (77%) Frame = -2 Query: 424 YWIIKNSWGENWGDKGYYKICRGSNVRNKCGVDSM 320 YWI+KNSWG WG+ GY++I RG+ ++C ++S+ Sbjct: 421 YWIVKNSWGSQWGESGYFRIRRGT---DECAIESI 452
>CATB_MOUSE (P10605) Cathepsin B precursor (EC 3.4.22.1) (Cathepsin B1)| [Contains: Cathepsin B light chain; Cathepsin B heavy chain] Length = 339 Score = 48.5 bits (114), Expect = 8e-06 Identities = 18/37 (48%), Positives = 25/37 (67%) Frame = -2 Query: 427 PYWIIKNSWGENWGDKGYYKICRGSNVRNKCGVDSMV 317 PYW+ NSW +WGD G++KI RG N CG++S + Sbjct: 292 PYWLAANSWNLDWGDNGFFKILRG---ENHCGIESEI 325
>CATV_NPVHC (Q9WGE0) Viral cathepsin (EC 3.4.22.50) (V-cath) (Cysteine| proteinase) (CP) Length = 324 Score = 48.1 bits (113), Expect = 1e-05 Identities = 16/33 (48%), Positives = 26/33 (78%) Frame = -2 Query: 427 PYWIIKNSWGENWGDKGYYKICRGSNVRNKCGV 329 PYWI+KN+WGE+WG++GY+++ + N CG+ Sbjct: 284 PYWILKNTWGEDWGEQGYFRVQQNINA---CGI 313
>CATLL_PHACE (O97397) Cathepsin L-like proteinase precursor (EC 3.4.22.-)| Length = 324 Score = 48.1 bits (113), Expect = 1e-05 Identities = 18/37 (48%), Positives = 27/37 (72%) Frame = -2 Query: 424 YWIIKNSWGENWGDKGYYKICRGSNVRNKCGVDSMVS 314 YWIIKN+WG +WG+ GY ++ R ++ + CGV+ M S Sbjct: 285 YWIIKNTWGADWGESGYIRLIRDTD--HSCGVEKMAS 319
>CATS_CANFA (Q8HY81) Cathepsin S precursor (EC 3.4.22.27)| Length = 331 Score = 48.1 bits (113), Expect = 1e-05 Identities = 20/39 (51%), Positives = 27/39 (69%) Frame = -2 Query: 430 KPYWIIKNSWGENWGDKGYYKICRGSNVRNKCGVDSMVS 314 K YW++KNSWG N+GD+GY ++ R S N CG+ S S Sbjct: 291 KDYWLVKNSWGLNFGDQGYIRMARNSG--NHCGIASYPS 327
>CPR1_ARATH (Q9LT77) Probable cysteine proteinase At3g19400 precursor (EC| 3.4.22.-) Length = 362 Score = 48.1 bits (113), Expect = 1e-05 Identities = 21/38 (55%), Positives = 25/38 (65%), Gaps = 1/38 (2%) Frame = -2 Query: 424 YWIIKNSWGENWGDKGYYKICRG-SNVRNKCGVDSMVS 314 YWII+NSWG NWGD GY K+ R + KCG+ M S Sbjct: 308 YWIIRNSWGLNWGDSGYVKLQRNIDDPFGKCGIAMMPS 345
>CPR5_CAEEL (P43509) Cathepsin B-like cysteine proteinase 5 precursor (EC| 3.4.22.-) (Cysteine protease-related 5) Length = 344 Score = 48.1 bits (113), Expect = 1e-05 Identities = 17/34 (50%), Positives = 25/34 (73%) Frame = -2 Query: 427 PYWIIKNSWGENWGDKGYYKICRGSNVRNKCGVD 326 PYW++ NSW WG+KGY++I RG N+CG++ Sbjct: 300 PYWLVANSWNVAWGEKGYFRIIRG---LNECGIE 330
>CATV_NPVHZ (Q8V5U0) Viral cathepsin (EC 3.4.22.50) (V-cath) (Cysteine| proteinase) (CP) Length = 367 Score = 48.1 bits (113), Expect = 1e-05 Identities = 19/40 (47%), Positives = 28/40 (70%), Gaps = 3/40 (7%) Frame = -2 Query: 427 PYWIIKNSWGENWGDKGYYKICRGSN---VRNKCGVDSMV 317 PYWIIKNSWGE+WG+ G+ ++ R N + N+ G S++ Sbjct: 327 PYWIIKNSWGEDWGENGFLRVRRNVNACGLLNEFGASSVI 366
>CYSP2_HAECO (P25793) Cathepsin B-like cysteine proteinase 2 precursor (EC| 3.4.22.-) Length = 342 Score = 48.1 bits (113), Expect = 1e-05 Identities = 17/37 (45%), Positives = 27/37 (72%) Frame = -2 Query: 424 YWIIKNSWGENWGDKGYYKICRGSNVRNKCGVDSMVS 314 +W+I NSW +WG+KGY++I RGS N CG++ ++ Sbjct: 300 FWLIANSWHNDWGEKGYFRIVRGS---NDCGIEGTIA 333
>CATH_PIG (O46427) Cathepsin H precursor (EC 3.4.22.16) [Contains: Cathepsin| H mini chain; Cathepsin H heavy chain; Cathepsin H light chain] Length = 335 Score = 48.1 bits (113), Expect = 1e-05 Identities = 20/38 (52%), Positives = 25/38 (65%) Frame = -2 Query: 427 PYWIIKNSWGENWGDKGYYKICRGSNVRNKCGVDSMVS 314 PYWI+KNSWG WG GY+ I RG +N CG+ + S Sbjct: 295 PYWIVKNSWGPQWGMNGYFLIERG---KNMCGLAACAS 329
>CATH_HUMAN (P09668) Cathepsin H precursor (EC 3.4.22.16) [Contains: Cathepsin| H mini chain; Cathepsin H heavy chain; Cathepsin H light chain] Length = 335 Score = 48.1 bits (113), Expect = 1e-05 Identities = 20/38 (52%), Positives = 25/38 (65%) Frame = -2 Query: 427 PYWIIKNSWGENWGDKGYYKICRGSNVRNKCGVDSMVS 314 PYWI+KNSWG WG GY+ I RG +N CG+ + S Sbjct: 295 PYWIVKNSWGPQWGMNGYFLIERG---KNMCGLAACAS 329
>CATH_MOUSE (P49935) Cathepsin H precursor (EC 3.4.22.16) (Cathepsin B3)| (Cathepsin BA) [Contains: Cathepsin H mini chain; Cathepsin H heavy chain; Cathepsin H light chain] Length = 333 Score = 47.8 bits (112), Expect = 1e-05 Identities = 19/37 (51%), Positives = 25/37 (67%) Frame = -2 Query: 424 YWIIKNSWGENWGDKGYYKICRGSNVRNKCGVDSMVS 314 YWI+KNSWG WG+ GY+ I RG +N CG+ + S Sbjct: 294 YWIVKNSWGSQWGENGYFLIERG---KNMCGLAACAS 327
>CATL_SHEEP (Q10991) Cathepsin L (EC 3.4.22.15) [Contains: Cathepsin L heavy| chain; Cathepsin L light chain] Length = 217 Score = 47.8 bits (112), Expect = 1e-05 Identities = 18/37 (48%), Positives = 25/37 (67%) Frame = -2 Query: 424 YWIIKNSWGENWGDKGYYKICRGSNVRNKCGVDSMVS 314 +WI+KNSWG WG+KGY K+ + N N CG+ + S Sbjct: 179 FWIVKNSWGPEWGNKGYVKMAKDQN--NHCGIATAAS 213
>CATV_NPVEP (Q91GE3) Viral cathepsin (EC 3.4.22.50) (V-cath) (Cysteine| proteinase) (CP) Length = 323 Score = 47.8 bits (112), Expect = 1e-05 Identities = 19/41 (46%), Positives = 31/41 (75%) Frame = -2 Query: 427 PYWIIKNSWGENWGDKGYYKICRGSNVRNKCGVDSMVSTVS 305 PYWI+KNSWG +WG++G++KI NV N CG+ + +++ + Sbjct: 283 PYWILKNSWGTDWGEQGFFKI--QQNV-NACGIKNELASTA 320
>CYSP_TRYCR (P25779) Cruzipain precursor (EC 3.4.22.51) (Major cysteine| proteinase) (Cruzaine) Length = 467 Score = 47.8 bits (112), Expect = 1e-05 Identities = 17/26 (65%), Positives = 21/26 (80%) Frame = -2 Query: 427 PYWIIKNSWGENWGDKGYYKICRGSN 350 PYWIIKNSW WG++GY +I +GSN Sbjct: 298 PYWIIKNSWTTQWGEEGYIRIAKGSN 323
>CATV_NPVST (Q91BH1) Viral cathepsin (EC 3.4.22.50) (V-cath) (Cysteine| proteinase) (CP) Length = 337 Score = 47.8 bits (112), Expect = 1e-05 Identities = 18/35 (51%), Positives = 23/35 (65%) Frame = -2 Query: 433 EKPYWIIKNSWGENWGDKGYYKICRGSNVRNKCGV 329 + PYWI KNSWG NWG+ GY++ R N CG+ Sbjct: 295 DTPYWIFKNSWGSNWGENGYFRARRNINA---CGM 326
>CYSP2_LEIPI (Q05094) Cysteine proteinase 2 precursor (EC 3.4.22.-) (Amastigote| cysteine proteinase A-2) Length = 444 Score = 47.4 bits (111), Expect = 2e-05 Identities = 16/28 (57%), Positives = 22/28 (78%) Frame = -2 Query: 433 EKPYWIIKNSWGENWGDKGYYKICRGSN 350 E PYW+IKNSWG +WG++GY ++ G N Sbjct: 301 EVPYWVIKNSWGGDWGEQGYVRVVMGVN 328
>CPGP1_ZINOF (P82473) Cysteine proteinase GP-I (EC 3.4.22.-)| Length = 221 Score = 47.4 bits (111), Expect = 2e-05 Identities = 17/36 (47%), Positives = 25/36 (69%), Gaps = 1/36 (2%) Frame = -2 Query: 433 EKPYWIIKNSWGENWGDKGYYKICRG-SNVRNKCGV 329 +K YW +KNSWG+NWG+ GY ++ R + KCG+ Sbjct: 173 DKDYWTVKNSWGKNWGESGYIRVERNIAESSGKCGI 208
>CATR_MOUSE (Q9JIA9) Cathepsin R precursor (EC 3.4.22.-)| Length = 334 Score = 47.4 bits (111), Expect = 2e-05 Identities = 18/34 (52%), Positives = 24/34 (70%) Frame = -2 Query: 424 YWIIKNSWGENWGDKGYYKICRGSNVRNKCGVDS 323 YW+IKNSWG+ WG +GY K+ + N N CG+ S Sbjct: 296 YWLIKNSWGKRWGIRGYMKLAKDKN--NHCGIAS 327
>CATK_CHICK (Q90686) Cathepsin K precursor (EC 3.4.22.38) (JTAP-1)| Length = 334 Score = 47.4 bits (111), Expect = 2e-05 Identities = 19/41 (46%), Positives = 27/41 (65%) Frame = -2 Query: 436 KEKPYWIIKNSWGENWGDKGYYKICRGSNVRNKCGVDSMVS 314 K +WIIKNSWG WG+KGY + R N++ CG+ ++ S Sbjct: 292 KGTKHWIIKNSWGTEWGNKGYVLLAR--NMKQTCGIANLAS 330
>SERA_PLAFG (P69192) Serine-repeat antigen protein precursor (p126) (111 kDa| antigen) Length = 989 Score = 47.4 bits (111), Expect = 2e-05 Identities = 16/34 (47%), Positives = 24/34 (70%) Frame = -2 Query: 466 GASGFAPSRFKEKPYWIIKNSWGENWGDKGYYKI 365 G + S ++K YWI++NSWG WGD+GY+K+ Sbjct: 760 GYGNYVNSEGEKKSYWIVRNSWGPYWGDEGYFKV 793
>SERA_PLAFD (P69193) Serine-repeat antigen protein precursor (p126) (111 kDa| antigen) Length = 989 Score = 47.4 bits (111), Expect = 2e-05 Identities = 16/34 (47%), Positives = 24/34 (70%) Frame = -2 Query: 466 GASGFAPSRFKEKPYWIIKNSWGENWGDKGYYKI 365 G + S ++K YWI++NSWG WGD+GY+K+ Sbjct: 760 GYGNYVNSEGEKKSYWIVRNSWGPYWGDEGYFKV 793
>SERA_PLAF7 (Q9TY95) Serine-repeat antigen protein precursor (p126) (111 kDa| antigen) Length = 997 Score = 47.4 bits (111), Expect = 2e-05 Identities = 16/34 (47%), Positives = 24/34 (70%) Frame = -2 Query: 466 GASGFAPSRFKEKPYWIIKNSWGENWGDKGYYKI 365 G + S ++K YWI++NSWG WGD+GY+K+ Sbjct: 768 GYGNYVNSEGEKKSYWIVRNSWGPYWGDEGYFKV 801
>LMCPB_LEIME (P36400) Cysteine proteinase B precursor (EC 3.4.22.-)| Length = 443 Score = 47.4 bits (111), Expect = 2e-05 Identities = 16/28 (57%), Positives = 22/28 (78%) Frame = -2 Query: 433 EKPYWIIKNSWGENWGDKGYYKICRGSN 350 E PYW+IKNSWG +WG++GY ++ G N Sbjct: 300 EVPYWVIKNSWGGDWGEQGYVRVVMGVN 327
>CATS_HUMAN (P25774) Cathepsin S precursor (EC 3.4.22.27)| Length = 331 Score = 47.4 bits (111), Expect = 2e-05 Identities = 19/39 (48%), Positives = 27/39 (69%) Frame = -2 Query: 430 KPYWIIKNSWGENWGDKGYYKICRGSNVRNKCGVDSMVS 314 K YW++KNSWG N+G++GY ++ R N N CG+ S S Sbjct: 291 KEYWLVKNSWGHNFGEEGYIRMAR--NKGNHCGIASFPS 327
>CATQ_RAT (Q9QZE3) Cathepsin Q precursor (EC 3.4.22.-)| Length = 343 Score = 47.0 bits (110), Expect = 2e-05 Identities = 20/46 (43%), Positives = 27/46 (58%) Frame = -2 Query: 457 GFAPSRFKEKPYWIIKNSWGENWGDKGYYKICRGSNVRNKCGVDSM 320 GF + YW+IKNSWG+ WG +GY KI + N N C + S+ Sbjct: 294 GFEGNETDGNNYWLIKNSWGKRWGLRGYMKIAKDRN--NHCAIASL 337
>CATS_SAIBB (Q8HY82) Cathepsin S precursor (EC 3.4.22.27)| Length = 330 Score = 47.0 bits (110), Expect = 2e-05 Identities = 19/39 (48%), Positives = 27/39 (69%) Frame = -2 Query: 430 KPYWIIKNSWGENWGDKGYYKICRGSNVRNKCGVDSMVS 314 K YW++KNSWG N+G++GY ++ R N N CG+ S S Sbjct: 290 KEYWLVKNSWGSNFGEQGYIRMAR--NKGNHCGIASYPS 326
>CATS_RAT (Q02765) Cathepsin S precursor (EC 3.4.22.27)| Length = 330 Score = 47.0 bits (110), Expect = 2e-05 Identities = 19/39 (48%), Positives = 28/39 (71%) Frame = -2 Query: 430 KPYWIIKNSWGENWGDKGYYKICRGSNVRNKCGVDSMVS 314 K YW++KNSWG ++GD+GY ++ R N +N CG+ S S Sbjct: 290 KDYWLVKNSWGLHFGDQGYIRMAR--NNKNHCGIASYCS 326
>CYSP_THEPA (P22497) Cysteine proteinase precursor (EC 3.4.22.-)| Length = 440 Score = 47.0 bits (110), Expect = 2e-05 Identities = 16/35 (45%), Positives = 26/35 (74%) Frame = -2 Query: 433 EKPYWIIKNSWGENWGDKGYYKICRGSNVRNKCGV 329 +K YW+++NSWG +WG+ GY ++ R + +KCGV Sbjct: 396 KKRYWVVQNSWGTDWGENGYMRLERTNMGTDKCGV 430
>CYSP1_HAECO (P19092) Cathepsin B-like cysteine proteinase 1 precursor (EC| 3.4.22.-) Length = 342 Score = 47.0 bits (110), Expect = 2e-05 Identities = 16/37 (43%), Positives = 27/37 (72%) Frame = -2 Query: 424 YWIIKNSWGENWGDKGYYKICRGSNVRNKCGVDSMVS 314 +W+I NSW +WG+KGY++I RG+ N CG++ ++ Sbjct: 300 FWLIANSWHNDWGEKGYFRIIRGT---NDCGIEGTIA 333
>CYSP2_DICDI (P04989) Cysteine proteinase 2 precursor (EC 3.4.22.-) (Prestalk| cathepsin) Length = 376 Score = 47.0 bits (110), Expect = 2e-05 Identities = 21/43 (48%), Positives = 27/43 (62%) Frame = -2 Query: 442 RFKEKPYWIIKNSWGENWGDKGYYKICRGSNVRNKCGVDSMVS 314 R K YWI+KNSWG +WG KGY I + +N CG+ S+ S Sbjct: 332 RPKANNYWIVKNSWGTSWGIKGY--ILMSKDRKNNCGIASVSS 372
>CYSP1_OSTOS (P25802) Cathepsin B-like cysteine proteinase 1 precursor (EC| 3.4.22.-) Length = 341 Score = 47.0 bits (110), Expect = 2e-05 Identities = 18/44 (40%), Positives = 29/44 (65%) Frame = -2 Query: 436 KEKPYWIIKNSWGENWGDKGYYKICRGSNVRNKCGVDSMVSTVS 305 K PYWI+ NSW ++WG+ G++++ RGS N CG + ++ S Sbjct: 299 KGTPYWIVANSWHDDWGENGFFRMHRGS---NDCGFEERMAAGS 339
>CATB2_GIALA (P92132) Cathepsin B-like CP2 precursor (EC 3.4.22.-) (Cathepsin| B-like protease B2) Length = 300 Score = 46.6 bits (109), Expect = 3e-05 Identities = 16/25 (64%), Positives = 21/25 (84%) Frame = -2 Query: 424 YWIIKNSWGENWGDKGYYKICRGSN 350 YWIIKNSWG +WG+ GY+++ RG N Sbjct: 261 YWIIKNSWGPDWGEDGYFRMIRGIN 285
>CYSP2_HOMAM (P25782) Digestive cysteine proteinase 2 precursor (EC 3.4.22.-)| Length = 323 Score = 46.6 bits (109), Expect = 3e-05 Identities = 17/37 (45%), Positives = 25/37 (67%) Frame = -2 Query: 424 YWIIKNSWGENWGDKGYYKICRGSNVRNKCGVDSMVS 314 +W++KNSW +WGD GY K+ R N N CG+ ++ S Sbjct: 285 FWLVKNSWATSWGDAGYIKMSRNRN--NNCGIATVAS 319
>CATL_RAT (P07154) Cathepsin L precursor (EC 3.4.22.15) (Major excreted| protein) (MEP) (Cyclic protein 2) (CP-2) [Contains: Cathepsin L heavy chain; Cathepsin L light chain] Length = 334 Score = 46.6 bits (109), Expect = 3e-05 Identities = 22/52 (42%), Positives = 30/52 (57%) Frame = -2 Query: 469 YGASGFAPSRFKEKPYWIIKNSWGENWGDKGYYKICRGSNVRNKCGVDSMVS 314 YG G ++ K YW++KNSWG+ WG GY KI + N N CG+ + S Sbjct: 283 YGYEGTDSNKDK---YWLVKNSWGKEWGMDGYIKIAKDRN--NHCGLATAAS 329
>CATL_PIG (Q28944) Cathepsin L precursor (EC 3.4.22.15) [Contains: Cathepsin| L heavy chain; Cathepsin L light chain] Length = 334 Score = 46.6 bits (109), Expect = 3e-05 Identities = 19/48 (39%), Positives = 26/48 (54%) Frame = -2 Query: 457 GFAPSRFKEKPYWIIKNSWGENWGDKGYYKICRGSNVRNKCGVDSMVS 314 GF + +WI+KNSWG WG GY K+ + N N CG+ + S Sbjct: 285 GFEGTDSNSSKFWIVKNSWGPEWGWNGYVKMAKDQN--NHCGISTAAS 330
>RD21A_ARATH (P43297) Cysteine proteinase RD21a precursor (EC 3.4.22.-) (RD21)| Length = 462 Score = 46.6 bits (109), Expect = 3e-05 Identities = 16/35 (45%), Positives = 26/35 (74%), Gaps = 1/35 (2%) Frame = -2 Query: 430 KPYWIIKNSWGENWGDKGYYKICRG-SNVRNKCGV 329 K YWI++NSWG++WG+ GY ++ R ++ KCG+ Sbjct: 310 KDYWIVRNSWGKSWGESGYLRMARNIASSSGKCGI 344
>CATO_MOUSE (Q8BM88) Cathepsin O precursor (EC 3.4.22.42)| Length = 312 Score = 46.6 bits (109), Expect = 3e-05 Identities = 18/40 (45%), Positives = 26/40 (65%) Frame = -2 Query: 427 PYWIIKNSWGENWGDKGYYKICRGSNVRNKCGVDSMVSTV 308 PYW+++NSWG +WG +GY + G NV CG+ V+ V Sbjct: 274 PYWMVRNSWGSSWGVEGYAHVKMGGNV---CGIADSVAAV 310
>CATV_NPVAH (Q80LP4) Viral cathepsin (EC 3.4.22.50) (V-cath) (Cysteine| proteinase) (CP) Length = 337 Score = 46.6 bits (109), Expect = 3e-05 Identities = 16/43 (37%), Positives = 28/43 (65%) Frame = -2 Query: 424 YWIIKNSWGENWGDKGYYKICRGSNVRNKCGVDSMVSTVSATH 296 YW +KNSWG +WG+ GY+++ R N CG+++ ++ + H Sbjct: 298 YWTLKNSWGSDWGEDGYFRVKRNINA---CGLNNQLAASATIH 337
>ACTN_ACTCH (P00785) Actinidain precursor (EC 3.4.22.14) (Actinidin) (Allergen| Act c 1) Length = 380 Score = 46.2 bits (108), Expect = 4e-05 Identities = 17/37 (45%), Positives = 23/37 (62%) Frame = -2 Query: 424 YWIIKNSWGENWGDKGYYKICRGSNVRNKCGVDSMVS 314 YWI+KNSW WG++GY +I R CG+ +M S Sbjct: 303 YWIVKNSWDTTWGEEGYMRILRNVGGAGTCGIATMPS 339
>CATL_BOVIN (P25975) Cathepsin L precursor (EC 3.4.22.15) [Contains: Cathepsin| L heavy chain; Cathepsin L light chain] Length = 334 Score = 45.8 bits (107), Expect = 5e-05 Identities = 19/48 (39%), Positives = 26/48 (54%) Frame = -2 Query: 457 GFAPSRFKEKPYWIIKNSWGENWGDKGYYKICRGSNVRNKCGVDSMVS 314 GF + +WI+KNSWG WG GY K+ + N N CG+ + S Sbjct: 285 GFEGTDSNNNKFWIVKNSWGPEWGWNGYVKMAKDQN--NHCGIATAAS 330
>CATV_NPVLD (Q9YMP9) Viral cathepsin (EC 3.4.22.50) (V-cath) (Cysteine| proteinase) (CP) Length = 356 Score = 45.8 bits (107), Expect = 5e-05 Identities = 19/40 (47%), Positives = 29/40 (72%), Gaps = 1/40 (2%) Frame = -2 Query: 427 PYWIIKNSWGENWGDKGYYKICRGSNVRNKCG-VDSMVST 311 PYW+ KN+WG++WG+ GY+++ NV N CG V+ + ST Sbjct: 316 PYWVFKNTWGDDWGENGYFRV--RQNV-NACGMVNDLAST 352
>PAPA2_CARPA (P14080) Chymopapain precursor (EC 3.4.22.6) (Papaya proteinase II)| (PPII) Length = 352 Score = 45.8 bits (107), Expect = 5e-05 Identities = 21/35 (60%), Positives = 25/35 (71%), Gaps = 1/35 (2%) Frame = -2 Query: 430 KPYWIIKNSWGENWGDKGYYKICRGS-NVRNKCGV 329 K Y IIKNSWG NWG+KGY ++ R S N + CGV Sbjct: 306 KNYIIIKNSWGPNWGEKGYMRLKRQSGNSQGTCGV 340
>CYSP_TRYBB (P14658) Cysteine proteinase precursor (EC 3.4.22.-)| Length = 450 Score = 45.4 bits (106), Expect = 7e-05 Identities = 19/39 (48%), Positives = 27/39 (69%) Frame = -2 Query: 427 PYWIIKNSWGENWGDKGYYKICRGSNVRNKCGVDSMVST 311 PYWIIKNSW WG+ GY +I +G+ N+C ++ VS+ Sbjct: 301 PYWIIKNSWSNMWGEDGYIRIEKGT---NQCLMNQAVSS 336
>CATV_NPVSE (Q9J8B9) Viral cathepsin (EC 3.4.22.50) (V-cath) (Cysteine| proteinase) (CP) Length = 337 Score = 45.4 bits (106), Expect = 7e-05 Identities = 18/33 (54%), Positives = 24/33 (72%) Frame = -2 Query: 427 PYWIIKNSWGENWGDKGYYKICRGSNVRNKCGV 329 PYWIIKNSWG ++G+ GY ++ RG N CG+ Sbjct: 297 PYWIIKNSWGSDYGEDGYVRVRRGV---NSCGM 326
>TEST2_RAT (P15242) Testin 2 precursor (CMB-23) [Contains: Testin 1 (CMB-22)]| Length = 333 Score = 45.4 bits (106), Expect = 7e-05 Identities = 18/43 (41%), Positives = 25/43 (58%) Frame = -2 Query: 457 GFAPSRFKEKPYWIIKNSWGENWGDKGYYKICRGSNVRNKCGV 329 GF +W++KNSWGE WG KGY K+ + + N CG+ Sbjct: 284 GFEGEESDGNSFWLVKNSWGEEWGMKGYMKLAK--DWSNHCGI 324
>CYSP4_DICDI (P54639) Cysteine proteinase 4 precursor (EC 3.4.22.-)| Length = 442 Score = 45.4 bits (106), Expect = 7e-05 Identities = 19/42 (45%), Positives = 27/42 (64%) Frame = -2 Query: 424 YWIIKNSWGENWGDKGYYKICRGSNVRNKCGVDSMVSTVSAT 299 YWI+KNSWG +WG GY + + N N CG+ +M S +A+ Sbjct: 401 YWIVKNSWGTSWGMDGYIFMSKDRN--NNCGIATMASFPTAS 440
>CYSP1_ORYSA (Q7XR52) Cysteine protease 1 precursor (EC 3.4.22.-) (OsCP1)| Length = 490 Score = 45.4 bits (106), Expect = 7e-05 Identities = 19/51 (37%), Positives = 27/51 (52%), Gaps = 1/51 (1%) Frame = -2 Query: 463 ASGFAPSRFKEKPYWIIKNSWGENWGDKGYYKICRGSNVR-NKCGVDSMVS 314 A G+ YW ++NSWG +WG+ GY ++ R R KCG+ M S Sbjct: 321 AVGYGTDAATGAAYWTVRNSWGPDWGENGYIRMERNVTARTGKCGIAMMAS 371
>CATV_NPVOP (O10364) Viral cathepsin (EC 3.4.22.50) (V-cath) (Cysteine| proteinase) (CP) Length = 324 Score = 45.1 bits (105), Expect = 9e-05 Identities = 15/33 (45%), Positives = 24/33 (72%) Frame = -2 Query: 427 PYWIIKNSWGENWGDKGYYKICRGSNVRNKCGV 329 PYWI+KN+WG +WG+ GY+++ + N CG+ Sbjct: 284 PYWILKNTWGTDWGEDGYFRVQQNINA---CGI 313
>CATS_BOVIN (P25326) Cathepsin S (EC 3.4.22.27)| Length = 217 Score = 45.1 bits (105), Expect = 9e-05 Identities = 17/34 (50%), Positives = 25/34 (73%) Frame = -2 Query: 430 KPYWIIKNSWGENWGDKGYYKICRGSNVRNKCGV 329 K YW++KNSWG ++GD+GY ++ R S N CG+ Sbjct: 177 KDYWLVKNSWGLHFGDQGYIRMARNSG--NHCGI 208
>CATL_MOUSE (P06797) Cathepsin L precursor (EC 3.4.22.15) (Major excreted| protein) (MEP) (p39 cysteine proteinase) [Contains: Cathepsin L heavy chain; Cathepsin L light chain] Length = 334 Score = 45.1 bits (105), Expect = 9e-05 Identities = 18/48 (37%), Positives = 28/48 (58%) Frame = -2 Query: 457 GFAPSRFKEKPYWIIKNSWGENWGDKGYYKICRGSNVRNKCGVDSMVS 314 G+ + + YW++KNSWG WG +GY KI + + N CG+ + S Sbjct: 284 GYEGTDSNKNKYWLVKNSWGSEWGMEGYIKIAKDRD--NHCGLATAAS 329
>CYSP5_DICDI (P54640) Cysteine proteinase 5 precursor (EC 3.4.22.-)| Length = 344 Score = 45.1 bits (105), Expect = 9e-05 Identities = 22/51 (43%), Positives = 27/51 (52%) Frame = -2 Query: 466 GASGFAPSRFKEKPYWIIKNSWGENWGDKGYYKICRGSNVRNKCGVDSMVS 314 G S S YWI+KNSWG +WG +GY + R N N CG+ S S Sbjct: 292 GQSSGNLSASSSNEYWIVKNSWGTSWGIEGYILMSR--NRDNNCGIASSAS 340
>CATC_PLAF7 (Q8IIJ9) Probable cathepsin C precursor (EC 3.4.22.-)| Length = 700 Score = 45.1 bits (105), Expect = 9e-05 Identities = 16/25 (64%), Positives = 19/25 (76%) Frame = -2 Query: 424 YWIIKNSWGENWGDKGYYKICRGSN 350 YWI +NSWG WG +GY+KI RG N Sbjct: 643 YWIGRNSWGNGWGKEGYFKILRGQN 667
>MEX1_JACME (P84346) Mexicain (EC 3.4.22.-)| Length = 214 Score = 44.7 bits (104), Expect = 1e-04 Identities = 19/35 (54%), Positives = 24/35 (68%), Gaps = 1/35 (2%) Frame = -2 Query: 430 KPYWIIKNSWGENWGDKGYYKICRGS-NVRNKCGV 329 K Y ++KNSWG NWG+KGY +I R S + CGV Sbjct: 168 KTYLLLKNSWGPNWGEKGYIRIKRASGRSKGTCGV 202
>CATL_FELCA (P25773) Cathepsin L (EC 3.4.22.15) (Progesterone-dependent| protein) (PDP) (Fragment) Length = 139 Score = 44.7 bits (104), Expect = 1e-04 Identities = 19/37 (51%), Positives = 24/37 (64%) Frame = -2 Query: 469 YGASGFAPSRFKEKPYWIIKNSWGENWGDKGYYKICR 359 YGA G + + K YWIIKNSWG +WG GY K+ + Sbjct: 104 YGADG---TETENKKYWIIKNSWGTDWGMDGYIKMAK 137
>CYSEP_RICCO (O65039) Vignain precursor (EC 3.4.22.-) (Cysteine endopeptidase)| Length = 360 Score = 44.7 bits (104), Expect = 1e-04 Identities = 17/33 (51%), Positives = 23/33 (69%), Gaps = 1/33 (3%) Frame = -2 Query: 424 YWIIKNSWGENWGDKGYYKICRG-SNVRNKCGV 329 YW +KNSWG WG+KGY ++ RG S+ CG+ Sbjct: 302 YWTVKNSWGPEWGEKGYIRMERGISDKEGLCGI 334
>CATM_MOUSE (Q9JL96) Cathepsin M precursor (EC 3.4.22.-)| Length = 333 Score = 44.7 bits (104), Expect = 1e-04 Identities = 19/43 (44%), Positives = 24/43 (55%) Frame = -2 Query: 457 GFAPSRFKEKPYWIIKNSWGENWGDKGYYKICRGSNVRNKCGV 329 GF + YW++KNS G WG+KGY KI R N CG+ Sbjct: 284 GFTGRESDGRKYWLVKNSMGTQWGNKGYMKISRDKG--NHCGI 324
>BROM1_ANACO (O23791) Bromelain precursor (EC 3.4.22.32) (Allergen Ana c 2)| Length = 351 Score = 44.7 bits (104), Expect = 1e-04 Identities = 16/33 (48%), Positives = 24/33 (72%), Gaps = 1/33 (3%) Frame = -2 Query: 424 YWIIKNSWGENWGDKGYYKICRG-SNVRNKCGV 329 YWI++NSWG +WG+ GY ++ RG S+ CG+ Sbjct: 295 YWIVRNSWGSSWGEGGYVRMARGVSSSSGVCGI 327
>CPR6_CAEEL (P43510) Cathepsin B-like cysteine proteinase 6 precursor (EC| 3.4.22.-) (Cysteine protease-related 6) Length = 379 Score = 44.7 bits (104), Expect = 1e-04 Identities = 16/37 (43%), Positives = 26/37 (70%) Frame = -2 Query: 427 PYWIIKNSWGENWGDKGYYKICRGSNVRNKCGVDSMV 317 PYW + NSW +WG+ G+++I RG ++CG++S V Sbjct: 319 PYWTVANSWNTDWGEDGFFRILRGV---DECGIESGV 352
>ORYA_ORYSA (P25776) Oryzain alpha chain precursor (EC 3.4.22.-)| Length = 458 Score = 44.7 bits (104), Expect = 1e-04 Identities = 16/35 (45%), Positives = 25/35 (71%), Gaps = 1/35 (2%) Frame = -2 Query: 430 KPYWIIKNSWGENWGDKGYYKICRGSNVRN-KCGV 329 K YWI++NSWG++WG+ GY ++ R + KCG+ Sbjct: 302 KDYWIVRNSWGKSWGESGYVRMERNIKASSGKCGI 336
>CATV_NPVCF (P41715) Viral cathepsin (EC 3.4.22.50) (V-cath) (Cysteine| proteinase) (CP) Length = 324 Score = 44.7 bits (104), Expect = 1e-04 Identities = 14/35 (40%), Positives = 26/35 (74%) Frame = -2 Query: 427 PYWIIKNSWGENWGDKGYYKICRGSNVRNKCGVDS 323 P+WI+KN+WG +WG++GY+++ + N CG+ + Sbjct: 284 PFWILKNTWGADWGEQGYFRVQQNINA---CGIQN 315
>CATV_NPVCD (O41479) Viral cathepsin (EC 3.4.22.50) (V-cath) (Cysteine| proteinase) (CP) Length = 324 Score = 44.7 bits (104), Expect = 1e-04 Identities = 14/35 (40%), Positives = 26/35 (74%) Frame = -2 Query: 427 PYWIIKNSWGENWGDKGYYKICRGSNVRNKCGVDS 323 P+WI+KN+WG +WG++GY+++ + N CG+ + Sbjct: 284 PFWILKNTWGADWGEQGYFRVQQNINA---CGIQN 315
>CATV_NPVAP (Q91CL9) Viral cathepsin (EC 3.4.22.50) (V-cath) (Cysteine| proteinase) (CP) Length = 324 Score = 44.3 bits (103), Expect = 2e-04 Identities = 14/33 (42%), Positives = 25/33 (75%) Frame = -2 Query: 427 PYWIIKNSWGENWGDKGYYKICRGSNVRNKCGV 329 P+WI+KN+WG +WG++GY+++ + N CG+ Sbjct: 284 PFWILKNTWGADWGEQGYFRVQQNINA---CGI 313
>CATV_NPVMC (Q8QLK1) Viral cathepsin (EC 3.4.22.50) (V-cath) (Cysteine| proteinase) (CP) Length = 337 Score = 44.3 bits (103), Expect = 2e-04 Identities = 18/33 (54%), Positives = 23/33 (69%) Frame = -2 Query: 427 PYWIIKNSWGENWGDKGYYKICRGSNVRNKCGV 329 PYW IKNSWG ++G+ GY +I RG N CG+ Sbjct: 297 PYWTIKNSWGSDYGENGYVRIRRGV---NSCGM 326
>CPR3_CAEEL (P43507) Cathepsin B-like cysteine proteinase 3 precursor (EC| 3.4.22.-) (Cysteine protease-related 3) Length = 370 Score = 44.3 bits (103), Expect = 2e-04 Identities = 22/51 (43%), Positives = 32/51 (62%), Gaps = 3/51 (5%) Frame = -2 Query: 424 YWIIKNSWGENWGDKGYYKICRGSNVRNKCGVDSMVSTVSA---THSSKEE 281 YW+I NSWG ++G+KG++KI RG+ N+C ++ V A THS E Sbjct: 299 YWLIANSWGTSFGEKGFFKIRRGT---NECQIEGNVVAGIAKLGTHSETYE 346
>CYSP1_HOMAM (P13277) Digestive cysteine proteinase 1 precursor (EC 3.4.22.-)| Length = 322 Score = 44.3 bits (103), Expect = 2e-04 Identities = 15/32 (46%), Positives = 22/32 (68%) Frame = -2 Query: 424 YWIIKNSWGENWGDKGYYKICRGSNVRNKCGV 329 +W++KNSW +WG+ GY K+ R N N CG+ Sbjct: 284 FWLVKNSWATSWGESGYIKMARNRN--NNCGI 313
>CATL_CANFA (Q9GL24) Cathepsin L precursor (EC 3.4.22.15) [Contains: Cathepsin| L heavy chain; Cathepsin L light chain] Length = 333 Score = 43.9 bits (102), Expect = 2e-04 Identities = 17/37 (45%), Positives = 23/37 (62%) Frame = -2 Query: 424 YWIIKNSWGENWGDKGYYKICRGSNVRNKCGVDSMVS 314 +WI+KNSWG WG GY K+ + N N CG+ + S Sbjct: 295 FWIVKNSWGPEWGWNGYVKMAKDQN--NHCGIATAAS 329
>XCP2_ARATH (Q9LM66) Xylem cysteine proteinase 2 precursor (EC 3.4.22.-)| (AtXCP2) Length = 356 Score = 43.9 bits (102), Expect = 2e-04 Identities = 20/58 (34%), Positives = 30/58 (51%), Gaps = 1/58 (1%) Frame = -2 Query: 469 YGASGFAPSRFKEKPYWIIKNSWGENWGDKGYYKICRGS-NVRNKCGVDSMVSTVSAT 299 +G + K Y I+KNSWG WG+KGY ++ R + CG++ M S + T Sbjct: 298 HGVAAVGYGSSKGSDYIIVKNSWGPKWGEKGYIRLKRNTGKPEGLCGINKMASFPTKT 355
>CYSEP_VIGMU (P12412) Vignain precursor (EC 3.4.22.-) (Bean endopeptidase)| (Cysteine proteinase) (Sulfhydryl-endopeptidase) (SH-EP) [Contains: Vignain-1; Vignain-2] Length = 362 Score = 43.9 bits (102), Expect = 2e-04 Identities = 17/38 (44%), Positives = 24/38 (63%), Gaps = 1/38 (2%) Frame = -2 Query: 424 YWIIKNSWGENWGDKGYYKICRG-SNVRNKCGVDSMVS 314 YWI++NSWG WG++GY ++ R S CG+ M S Sbjct: 304 YWIVRNSWGPEWGEQGYIRMQRNISKKEGLCGIAMMAS 341
>CATB_CHICK (P43233) Cathepsin B precursor (EC 3.4.22.1) (Cathepsin B1)| [Contains: Cathepsin B light chain; Cathepsin B heavy chain] Length = 340 Score = 43.5 bits (101), Expect = 3e-04 Identities = 16/37 (43%), Positives = 24/37 (64%) Frame = -2 Query: 427 PYWIIKNSWGENWGDKGYYKICRGSNVRNKCGVDSMV 317 PYW+ NSW +WG G++KI RG + CG++S + Sbjct: 293 PYWLAANSWNTDWGITGFFKILRG---EDHCGIESEI 326
>CYSP_PLAVN (P46102) Cysteine proteinase precursor (EC 3.4.22.-)| Length = 506 Score = 43.5 bits (101), Expect = 3e-04 Identities = 18/33 (54%), Positives = 22/33 (66%) Frame = -2 Query: 424 YWIIKNSWGENWGDKGYYKICRGSNVRNKCGVD 326 YWI++NSWG NWG+ GY +I RNK G D Sbjct: 465 YWIVRNSWGPNWGEGGYIRI-----KRNKAGDD 492
>CPR4_ARATH (Q9SUS9) Probable cysteine proteinase At4g11320 precursor (EC| 3.4.22.-) Length = 371 Score = 43.5 bits (101), Expect = 3e-04 Identities = 17/35 (48%), Positives = 24/35 (68%), Gaps = 1/35 (2%) Frame = -2 Query: 430 KPYWIIKNSWGENWGDKGYYKICRG-SNVRNKCGV 329 + YWI+KNS G+ WG+ GY K+ R +N R CG+ Sbjct: 317 RDYWIVKNSRGDTWGEAGYMKMARNIANPRGLCGI 351
>CYSP2_HORVU (P25250) Cysteine proteinase EP-B 2 precursor (EC 3.4.22.-)| Length = 373 Score = 43.1 bits (100), Expect = 4e-04 Identities = 18/47 (38%), Positives = 27/47 (57%), Gaps = 1/47 (2%) Frame = -2 Query: 430 KPYWIIKNSWGENWGDKGYYKICRGSNVR-NKCGVDSMVSTVSATHS 293 K YW +KNSWG +WG++GY ++ + S CG+ S T+S Sbjct: 311 KAYWTVKNSWGPSWGEQGYIRVEKDSGASGGLCGIAMEASYPVKTYS 357
>CRUST_PANBO (Q86GF7) Crustapain precursor (EC 3.4.22.-) (NsCys)| Length = 323 Score = 43.1 bits (100), Expect = 4e-04 Identities = 17/32 (53%), Positives = 21/32 (65%) Frame = -2 Query: 424 YWIIKNSWGENWGDKGYYKICRGSNVRNKCGV 329 YWI+KNSWG WG+ GY K+ R N N C + Sbjct: 285 YWIVKNSWGAWWGESGYIKMAR--NRDNNCAI 314
>ERVB_TABDI (P60994) Ervatamin-B (EC 3.4.22.-) (ERV-B)| Length = 215 Score = 43.1 bits (100), Expect = 4e-04 Identities = 17/40 (42%), Positives = 27/40 (67%), Gaps = 1/40 (2%) Frame = -2 Query: 430 KPYWIIKNSWGENWGDKGYYKICRG-SNVRNKCGVDSMVS 314 K YWI++NSWG+NWG++GY + R ++ CG+ + S Sbjct: 171 KNYWIVRNSWGQNWGNQGYIWMERNVASSAGLCGIAQLPS 210
>CYSP_PLAFA (P25805) Trophozoite cysteine proteinase precursor (EC 3.4.22.-)| (TCP) Length = 569 Score = 43.1 bits (100), Expect = 4e-04 Identities = 17/37 (45%), Positives = 23/37 (62%), Gaps = 1/37 (2%) Frame = -2 Query: 424 YWIIKNSWGENWGDKGYYKICRGSNVRNK-CGVDSMV 317 YWIIKNSW + WG+ G+ ++ R N N CG+ V Sbjct: 528 YWIIKNSWSKKWGENGFMRLSRNKNGDNVFCGIGEEV 564
>CATV_GVXN (Q9PYY5) Viral cathepsin (EC 3.4.22.50) (V-cath) (Cysteine| proteinase) (CP) Length = 346 Score = 43.1 bits (100), Expect = 4e-04 Identities = 17/45 (37%), Positives = 28/45 (62%) Frame = -2 Query: 424 YWIIKNSWGENWGDKGYYKICRGSNVRNKCGVDSMVSTVSATHSS 290 YW +KNSWG +WG++G+++I R N CG+ + + + SS Sbjct: 304 YWTLKNSWGSDWGEQGFFRIKRDV---NSCGILNQFAASAILSSS 345
>TINAL_HUMAN (Q9GZM7) Tubulointerstitial nephritis antigen-like precursor| (Tubulointerstitial nephritis antigen-related protein) (TIN Ag-related protein) (TIN-Ag-RP) (Glucocorticoid-inducible protein 5) (Oxidized LDL-responsive gene 2 protein) (OLRG-2) Length = 467 Score = 42.7 bits (99), Expect = 5e-04 Identities = 16/36 (44%), Positives = 24/36 (66%) Frame = -2 Query: 424 YWIIKNSWGENWGDKGYYKICRGSNVRNKCGVDSMV 317 YW NSWG WG++G+++I RG N+C ++S V Sbjct: 420 YWTAANSWGPAWGERGHFRIVRGV---NECDIESFV 452
>GCP1_ARATH (Q94B08) Germination-specific cysteine protease 1 precursor (EC| 3.4.22.-) Length = 376 Score = 42.4 bits (98), Expect = 6e-04 Identities = 15/34 (44%), Positives = 24/34 (70%), Gaps = 2/34 (5%) Frame = -2 Query: 424 YWIIKNSWGENWGDKGYYKICR--GSNVRNKCGV 329 YWI++NSWG WG++GY ++ R ++ KCG+ Sbjct: 320 YWIVRNSWGPRWGEEGYIRMERNLAASKSGKCGI 353
>CYSP1_HORVU (P25249) Cysteine proteinase EP-B 1 precursor (EC 3.4.22.-)| Length = 371 Score = 42.0 bits (97), Expect = 8e-04 Identities = 15/35 (42%), Positives = 23/35 (65%), Gaps = 1/35 (2%) Frame = -2 Query: 430 KPYWIIKNSWGENWGDKGYYKICRGSNVR-NKCGV 329 K YW +KNSWG +WG++GY ++ + S CG+ Sbjct: 311 KAYWTVKNSWGPSWGEQGYIRVEKDSGASGGLCGI 345
>TINAG_HUMAN (Q9UJW2) Tubulointerstitial nephritis antigen (TIN-Ag)| Length = 476 Score = 42.0 bits (97), Expect = 8e-04 Identities = 16/29 (55%), Positives = 22/29 (75%) Frame = -2 Query: 436 KEKPYWIIKNSWGENWGDKGYYKICRGSN 350 KEK +WI N WG++WG+ GY++I RG N Sbjct: 428 KEK-FWIAANFWGKSWGENGYFRILRGVN 455
>CYSP4_BRANA (P25251) Cysteine proteinase COT44 precursor (EC 3.4.22.-)| (Fragment) Length = 328 Score = 42.0 bits (97), Expect = 8e-04 Identities = 15/33 (45%), Positives = 23/33 (69%), Gaps = 1/33 (3%) Frame = -2 Query: 424 YWIIKNSWGENWGDKGYYKICRG-SNVRNKCGV 329 YWI++NSWG WG+ GY ++ R ++ KCG+ Sbjct: 275 YWIVRNSWGTRWGEDGYIRMERNVASKSGKCGI 307
>XCP1_ARATH (O65493) Xylem cysteine proteinase 1 precursor (EC 3.4.22.-)| (AtXCP1) Length = 355 Score = 42.0 bits (97), Expect = 8e-04 Identities = 19/58 (32%), Positives = 30/58 (51%), Gaps = 1/58 (1%) Frame = -2 Query: 469 YGASGFAPSRFKEKPYWIIKNSWGENWGDKGYYKICRGS-NVRNKCGVDSMVSTVSAT 299 +G + K Y I+KNSWG WG+KG+ ++ R + CG++ M S + T Sbjct: 297 HGVAAVGYGSSKGSDYVIVKNSWGPRWGEKGFIRMKRNTGKPEGLCGINKMASYPTKT 354
>P34_SOYBN (P22895) P34 probable thiol protease precursor (EC 3.4.22.-)| Length = 379 Score = 42.0 bits (97), Expect = 8e-04 Identities = 21/49 (42%), Positives = 30/49 (61%), Gaps = 1/49 (2%) Frame = -2 Query: 424 YWIIKNSWGENWGDKGYYKICRGS-NVRNKCGVDSMVSTVSATHSSKEE 281 YWI KNSWG +WG+ GY I R + N+ CG++ A++ +KEE Sbjct: 316 YWIAKNSWGFDWGEDGYIWIQRNTGNLLGVCGMNYF-----ASYPTKEE 359
>TINAL_MOUSE (Q99JR5) Tubulointerstitial nephritis antigen-like precursor| (Androgen-regulated gene 1 protein) (Adrenocortical zonation factor 1) (AZ-1) (Tubulointersititial nephritis antigen-related protein) (TARP) Length = 466 Score = 42.0 bits (97), Expect = 8e-04 Identities = 15/36 (41%), Positives = 25/36 (69%) Frame = -2 Query: 424 YWIIKNSWGENWGDKGYYKICRGSNVRNKCGVDSMV 317 YW NSWG WG++G+++I RG+ N+C +++ V Sbjct: 419 YWTAANSWGPWWGERGHFRIVRGT---NECDIETFV 451
>CATV_NPVRO (Q8B9D5) Viral cathepsin (EC 3.4.22.50) (V-cath) (Cysteine| proteinase) (CP) Length = 323 Score = 41.6 bits (96), Expect = 0.001 Identities = 13/44 (29%), Positives = 29/44 (65%) Frame = -2 Query: 427 PYWIIKNSWGENWGDKGYYKICRGSNVRNKCGVDSMVSTVSATH 296 PYW KN+WG +WG++G++++ + N CG+ + +++ + + Sbjct: 283 PYWTFKNTWGTDWGEEGFFRVQQNINA---CGMRNELASTAVIY 323
>CATL_BRUPA (O17473) Cathepsin L-like precursor (EC 3.4.22.15)| Length = 395 Score = 41.6 bits (96), Expect = 0.001 Identities = 18/37 (48%), Positives = 22/37 (59%) Frame = -2 Query: 424 YWIIKNSWGENWGDKGYYKICRGSNVRNKCGVDSMVS 314 YWI+KNSWG +WG GY + R N N C + S S Sbjct: 358 YWIVKNSWGTDWGKDGYVYMAR--NRGNMCHIASAAS 392
>PAPA4_CARPA (P05994) Papaya proteinase 4 precursor (EC 3.4.22.25) (Papaya| proteinase IV) (PPIV) (Papaya peptidase B) (Glycyl endopeptidase) Length = 348 Score = 41.6 bits (96), Expect = 0.001 Identities = 23/48 (47%), Positives = 26/48 (54%), Gaps = 1/48 (2%) Frame = -2 Query: 469 YGASGFAPSRFKEKPYWIIKNSWGENWGDKGYYKICRGS-NVRNKCGV 329 YG SG K Y +IKNSWG WG+ GY +I R S N CGV Sbjct: 298 YGKSG-------GKGYILIKNSWGPGWGENGYIRIRRASGNSPGVCGV 338
>ERVC_TABDI (P83654) Ervatamin-C (EC 3.4.22.-) (ERV-C)| Length = 208 Score = 41.2 bits (95), Expect = 0.001 Identities = 13/22 (59%), Positives = 18/22 (81%) Frame = -2 Query: 424 YWIIKNSWGENWGDKGYYKICR 359 YWI++NSWG WG+KGY ++ R Sbjct: 168 YWIVRNSWGRYWGEKGYIRMLR 189
>ACP2_ENTHI (P36185) Cysteine proteinase ACP2 precursor (EC 3.4.22.-)| (Fragment) Length = 310 Score = 41.2 bits (95), Expect = 0.001 Identities = 17/34 (50%), Positives = 21/34 (61%) Frame = -2 Query: 430 KPYWIIKNSWGENWGDKGYYKICRGSNVRNKCGV 329 K WI++NSWG +WGDKGY + N CGV Sbjct: 267 KECWIVRNSWGTSWGDKGYINMVIEGNT---CGV 297
>CYSEP_PHAVU (P25803) Vignain precursor (EC 3.4.22.-) (Bean endopeptidase)| (Cysteine proteinase EP-C1) Length = 362 Score = 41.2 bits (95), Expect = 0.001 Identities = 16/38 (42%), Positives = 23/38 (60%), Gaps = 1/38 (2%) Frame = -2 Query: 424 YWIIKNSWGENWGDKGYYKICRG-SNVRNKCGVDSMVS 314 YWI++NSWG WG+ GY ++ R S CG+ + S Sbjct: 304 YWIVRNSWGPEWGEHGYIRMQRNISKKEGLCGIAMLPS 341
>CATZ_MOUSE (Q9WUU7) Cathepsin Z precursor (EC 3.4.22.-)| Length = 306 Score = 40.8 bits (94), Expect = 0.002 Identities = 13/20 (65%), Positives = 18/20 (90%) Frame = -2 Query: 424 YWIIKNSWGENWGDKGYYKI 365 YWI++NSWGE WG+KG+ +I Sbjct: 259 YWIVRNSWGEPWGEKGWMRI 278
>CPR3_ARATH (Q9SUT0) Probable cysteine proteinase At4g11310 precursor (EC| 3.4.22.-) Length = 364 Score = 40.8 bits (94), Expect = 0.002 Identities = 16/35 (45%), Positives = 23/35 (65%), Gaps = 1/35 (2%) Frame = -2 Query: 430 KPYWIIKNSWGENWGDKGYYKICRG-SNVRNKCGV 329 + YW++KNS G WG+ GY K+ R +N R CG+ Sbjct: 310 RDYWLVKNSRGITWGEAGYMKMARNIANPRGLCGI 344
>CPP3_ENTHI (Q06964) Cysteine proteinase 3 precursor (EC 3.4.22.-) (Cysteine| proteinase ACP3) (Fragment) Length = 308 Score = 40.8 bits (94), Expect = 0.002 Identities = 17/34 (50%), Positives = 20/34 (58%) Frame = -2 Query: 430 KPYWIIKNSWGENWGDKGYYKICRGSNVRNKCGV 329 K WI++NSWG WGDKGY + N CGV Sbjct: 265 KECWIVRNSWGTGWGDKGYINMVIEGNT---CGV 295
>CATV_NPVBM (P41721) Viral cathepsin (EC 3.4.22.50) (V-cath) (Cysteine| proteinase) (CP) Length = 323 Score = 40.8 bits (94), Expect = 0.002 Identities = 13/44 (29%), Positives = 28/44 (63%) Frame = -2 Query: 427 PYWIIKNSWGENWGDKGYYKICRGSNVRNKCGVDSMVSTVSATH 296 PYW KN+WG +WG+ G++++ + N CG+ + +++ + + Sbjct: 283 PYWTFKNTWGTDWGEDGFFRVQQNINA---CGMRNELASTAVIY 323
>CATV_NPVAC (P25783) Viral cathepsin (EC 3.4.22.50) (V-cath) (Cysteine| proteinase) (CP) Length = 323 Score = 40.8 bits (94), Expect = 0.002 Identities = 13/44 (29%), Positives = 28/44 (63%) Frame = -2 Query: 427 PYWIIKNSWGENWGDKGYYKICRGSNVRNKCGVDSMVSTVSATH 296 PYW KN+WG +WG+ G++++ + N CG+ + +++ + + Sbjct: 283 PYWTFKNTWGTDWGEDGFFRVQQNINA---CGMRNELASTAVIY 323
>TINAL_RAT (Q9EQT5) Tubulointerstitial nephritis antigen-like precursor| (Glucocorticoid-inducible protein 5) Length = 467 Score = 40.8 bits (94), Expect = 0.002 Identities = 15/36 (41%), Positives = 24/36 (66%) Frame = -2 Query: 424 YWIIKNSWGENWGDKGYYKICRGSNVRNKCGVDSMV 317 YW NSWG WG++G+++I RG N+C +++ V Sbjct: 420 YWTAANSWGPWWGERGHFRIVRGI---NECDIETFV 452
>ANAN_ANACO (P80884) Ananain precursor (EC 3.4.22.31)| Length = 345 Score = 40.8 bits (94), Expect = 0.002 Identities = 15/35 (42%), Positives = 23/35 (65%), Gaps = 1/35 (2%) Frame = -2 Query: 430 KPYWIIKNSWGENWGDKGYYKICRG-SNVRNKCGV 329 K +WI++NSWG WG+ GY ++ R S+ CG+ Sbjct: 293 KKFWIVRNSWGAGWGEGGYIRLARDVSSSFGLCGI 327
>CPP2_ENTHI (Q01958) Cysteine proteinase 2 precursor (EC 3.4.22.-)| Length = 315 Score = 40.8 bits (94), Expect = 0.002 Identities = 17/34 (50%), Positives = 20/34 (58%) Frame = -2 Query: 430 KPYWIIKNSWGENWGDKGYYKICRGSNVRNKCGV 329 K WI++NSWG WGDKGY + N CGV Sbjct: 272 KECWIVRNSWGTGWGDKGYINMVIEGNT---CGV 302
>MDO1_PSEMR (P83443) Macrodontain-1 (EC 3.4.22.-) (Macrodontain I)| Length = 213 Score = 40.8 bits (94), Expect = 0.002 Identities = 16/33 (48%), Positives = 22/33 (66%), Gaps = 1/33 (3%) Frame = -2 Query: 424 YWIIKNSWGENWGDKGYYKICRG-SNVRNKCGV 329 YWI++NSWG +WG GY +I R S+ CG+ Sbjct: 171 YWIVRNSWGSSWGQGGYVRIRRDVSHSGGVCGI 203
>PAPA1_CARPA (P00784) Papain precursor (EC 3.4.22.2) (Papaya proteinase I) (PPI)| (Allergen Car p 1) Length = 345 Score = 40.4 bits (93), Expect = 0.002 Identities = 20/46 (43%), Positives = 27/46 (58%), Gaps = 1/46 (2%) Frame = -2 Query: 463 ASGFAPSRFKEKPYWIIKNSWGENWGDKGYYKICRGS-NVRNKCGV 329 A G+ P+ Y +IKNSWG WG+ GY +I RG+ N CG+ Sbjct: 296 AVGYGPN------YILIKNSWGTGWGENGYIRIKRGTGNSYGVCGL 335
>PAPA3_CARPA (P10056) Caricain precursor (EC 3.4.22.30) (Papaya proteinase| omega) (Papaya proteinase III) (PPIII) (Papaya peptidase A) Length = 348 Score = 40.0 bits (92), Expect = 0.003 Identities = 22/48 (45%), Positives = 26/48 (54%), Gaps = 1/48 (2%) Frame = -2 Query: 469 YGASGFAPSRFKEKPYWIIKNSWGENWGDKGYYKICRG-SNVRNKCGV 329 YG SG K Y +IKNSWG WG+KGY +I R N CG+ Sbjct: 298 YGKSG-------GKGYILIKNSWGTAWGEKGYIRIKRAPGNSPGVCGL 338
>MEX2_JACME (P84347) Chymomexicain (EC 3.4.22.-)| Length = 215 Score = 40.0 bits (92), Expect = 0.003 Identities = 18/29 (62%), Positives = 19/29 (65%), Gaps = 1/29 (3%) Frame = -2 Query: 412 KNSWGENWGDKGYYKICRGS-NVRNKCGV 329 KNSWG NWG+KGY KI R S CGV Sbjct: 175 KNSWGPNWGEKGYIKIKRASGKSEGTCGV 203
>CYSP_PLAVS (P42666) Cysteine proteinase precursor (EC 3.4.22.-)| Length = 583 Score = 40.0 bits (92), Expect = 0.003 Identities = 16/33 (48%), Positives = 21/33 (63%), Gaps = 1/33 (3%) Frame = -2 Query: 424 YWIIKNSWGENWGDKGYYKICRGSNVRNK-CGV 329 YWIIKNSW + WG+ G+ +I R N CG+ Sbjct: 542 YWIIKNSWSKFWGENGFMRISRNKEGDNVFCGI 574
>CATV_NPVBS (Q9YWK4) Viral cathepsin (EC 3.4.22.50) (V-cath) (Cysteine| proteinase) (CP) Length = 331 Score = 40.0 bits (92), Expect = 0.003 Identities = 10/21 (47%), Positives = 19/21 (90%) Frame = -2 Query: 427 PYWIIKNSWGENWGDKGYYKI 365 P+W KN+WG++WG++GY+++ Sbjct: 288 PFWTFKNTWGKDWGEEGYFRV 308
>CATZ_RAT (Q9R1T3) Cathepsin Z precursor (EC 3.4.22.-) (Cathepsin Y)| Length = 306 Score = 39.7 bits (91), Expect = 0.004 Identities = 12/20 (60%), Positives = 18/20 (90%) Frame = -2 Query: 424 YWIIKNSWGENWGDKGYYKI 365 YWI++NSWGE WG++G+ +I Sbjct: 259 YWIVRNSWGEPWGERGWMRI 278
>CATZ_HUMAN (Q9UBR2) Cathepsin Z precursor (EC 3.4.22.-) (Cathepsin X)| (Cathepsin P) Length = 303 Score = 39.7 bits (91), Expect = 0.004 Identities = 12/20 (60%), Positives = 18/20 (90%) Frame = -2 Query: 424 YWIIKNSWGENWGDKGYYKI 365 YWI++NSWGE WG++G+ +I Sbjct: 256 YWIVRNSWGEPWGERGWLRI 275
>CPR2_ARATH (Q9LXW3) Probable cysteine proteinase At3g43960 precursor (EC| 3.4.22.-) Length = 376 Score = 39.7 bits (91), Expect = 0.004 Identities = 16/36 (44%), Positives = 21/36 (58%), Gaps = 1/36 (2%) Frame = -2 Query: 433 EKPYWIIKNSWGENWGDKGYYKICRG-SNVRNKCGV 329 E YW+I+NSWG WG+ GY ++ R KC V Sbjct: 303 EGDYWLIRNSWGPEWGEGGYLRLQRNFHEPTGKCAV 338
>CPP1_ENTHI (Q01957) Cysteine proteinase 1 precursor (EC 3.4.22.-)| Length = 315 Score = 39.3 bits (90), Expect = 0.005 Identities = 16/34 (47%), Positives = 20/34 (58%) Frame = -2 Query: 430 KPYWIIKNSWGENWGDKGYYKICRGSNVRNKCGV 329 K WI++NSWG WG+KGY + N CGV Sbjct: 272 KECWIVRNSWGTGWGEKGYINMVIEGNT---CGV 302
>CATZ_BOVIN (P05689) Cathepsin Z (EC 3.4.22.-) (Fragment)| Length = 73 Score = 38.5 bits (88), Expect = 0.009 Identities = 12/20 (60%), Positives = 17/20 (85%) Frame = -2 Query: 424 YWIIKNSWGENWGDKGYYKI 365 YWI++NSWGE WG+ G+ +I Sbjct: 26 YWIVRNSWGEPWGEHGWMRI 45
>DERP1_DERPT (P08176) Major mite fecal allergen Der p 1 precursor (EC 3.4.22.-)| (Der p I) Length = 320 Score = 38.5 bits (88), Expect = 0.009 Identities = 12/17 (70%), Positives = 14/17 (82%) Frame = -2 Query: 424 YWIIKNSWGENWGDKGY 374 YWI++NSW NWGD GY Sbjct: 283 YWIVRNSWDTNWGDNGY 299
>DERF1_DERFA (P16311) Major mite fecal allergen Der f 1 precursor (EC 3.4.22.-)| (Der f I) Length = 321 Score = 38.1 bits (87), Expect = 0.011 Identities = 13/26 (50%), Positives = 17/26 (65%) Frame = -2 Query: 424 YWIIKNSWGENWGDKGYYKICRGSNV 347 YWI++NSW WGD GY G+N+ Sbjct: 284 YWIVRNSWDTTWGDSGYGYFQAGNNL 309
>EURM1_EURMA (P25780) Mite group 1 allergen Eur m 1 precursor (EC 3.4.22.-) (Eur| m I) Length = 321 Score = 36.2 bits (82), Expect = 0.043 Identities = 11/17 (64%), Positives = 13/17 (76%) Frame = -2 Query: 424 YWIIKNSWGENWGDKGY 374 YWI++NSW WGD GY Sbjct: 284 YWIVRNSWDTTWGDNGY 300
>CYSPL_LYCES (P20721) Low-temperature-induced cysteine proteinase precursor (EC| 3.4.22.-) (Fragment) Length = 346 Score = 35.4 bits (80), Expect = 0.074 Identities = 14/33 (42%), Positives = 21/33 (63%), Gaps = 1/33 (3%) Frame = -2 Query: 424 YWIIKNSWGENWGDKGYYKICRG-SNVRNKCGV 329 YWI++NSWG N + GY ++ R S+ CG+ Sbjct: 193 YWIVRNSWGANCRENGYLRVQRNVSSSSGLCGL 225
>CATL1_PARTE (Q94714) Cathepsin L1 precursor (EC 3.4.22.15)| Length = 314 Score = 34.7 bits (78), Expect = 0.13 Identities = 12/31 (38%), Positives = 20/31 (64%) Frame = -2 Query: 421 WIIKNSWGENWGDKGYYKICRGSNVRNKCGV 329 W I+NSWG +WG+ G+ ++ G + CG+ Sbjct: 278 WKIRNSWGSSWGEAGHIRLAGG----DTCGI 304
>CATL2_PARTE (Q94715) Putative cathepsin L2 precursor (EC 3.4.22.15) (Fragment)| Length = 294 Score = 33.9 bits (76), Expect = 0.22 Identities = 12/31 (38%), Positives = 19/31 (61%) Frame = -2 Query: 421 WIIKNSWGENWGDKGYYKICRGSNVRNKCGV 329 WI++NSWG WG+ G ++ +N CG+ Sbjct: 260 WIVQNSWGTQWGESGNIRL----YPQNTCGI 286
>NEU2_ONCKE (Q91167) Isoticin-neurophysin IT 2 precursor [Contains: Isotocin| (IT); Neurophysin IT 2] Length = 156 Score = 32.3 bits (72), Expect = 0.63 Identities = 12/23 (52%), Positives = 15/23 (65%) Frame = -1 Query: 140 AATVCLLYNLCICSICYAHACDV 72 A +VCLLY L +CS CY C + Sbjct: 5 AVSVCLLYALSVCSACYISNCPI 27
>BLMH_CHICK (P87362) Bleomycin hydrolase (EC 3.4.22.40) (BLM hydrolase) (BMH)| (BH) (Aminopeptidase H) Length = 455 Score = 30.4 bits (67), Expect = 2.4 Identities = 10/16 (62%), Positives = 14/16 (87%) Frame = -2 Query: 421 WIIKNSWGENWGDKGY 374 W ++NSWGE+ G+KGY Sbjct: 392 WRVENSWGEDRGNKGY 407
>PEPW_LACDL (P94868) Aminopeptidase W (EC 3.4.22.-)| Length = 437 Score = 30.4 bits (67), Expect = 2.4 Identities = 9/17 (52%), Positives = 14/17 (82%) Frame = -2 Query: 421 WIIKNSWGENWGDKGYY 371 W ++NSWG+ G+KGY+ Sbjct: 378 WKVENSWGDKSGEKGYF 394
>PEPE_LACHE (P94870) Aminopeptidase E (EC 3.4.22.-)| Length = 438 Score = 30.4 bits (67), Expect = 2.4 Identities = 10/17 (58%), Positives = 13/17 (76%) Frame = -2 Query: 421 WIIKNSWGENWGDKGYY 371 W ++NSWG+ G KGYY Sbjct: 379 WKVENSWGDKSGAKGYY 395
>BLMH_MOUSE (Q8R016) Bleomycin hydrolase (EC 3.4.22.40) (BLM hydrolase) (BMH)| (BH) Length = 455 Score = 30.0 bits (66), Expect = 3.1 Identities = 10/16 (62%), Positives = 13/16 (81%) Frame = -2 Query: 421 WIIKNSWGENWGDKGY 374 W ++NSWGE+ G KGY Sbjct: 392 WRVENSWGEDHGHKGY 407
>BLMH_HUMAN (Q13867) Bleomycin hydrolase (EC 3.4.22.40) (BLM hydrolase) (BMH)| (BH) Length = 455 Score = 30.0 bits (66), Expect = 3.1 Identities = 10/16 (62%), Positives = 13/16 (81%) Frame = -2 Query: 421 WIIKNSWGENWGDKGY 374 W ++NSWGE+ G KGY Sbjct: 392 WRVENSWGEDHGHKGY 407
>PEPC_STRTR (Q56115) Aminopeptidase C (EC 3.4.22.40) (Bleomycin hydrolase)| Length = 445 Score = 30.0 bits (66), Expect = 3.1 Identities = 10/17 (58%), Positives = 13/17 (76%) Frame = -2 Query: 421 WIIKNSWGENWGDKGYY 371 W I+NSWG+ G KGY+ Sbjct: 381 WKIENSWGDKVGQKGYF 397
>NEUI_FUGRU (O42493) Isoticin-neurophysin IT 1 precursor [Contains: Isotocin| (IT); Neurophysin IT 1] Length = 155 Score = 30.0 bits (66), Expect = 3.1 Identities = 11/23 (47%), Positives = 15/23 (65%) Frame = -1 Query: 140 AATVCLLYNLCICSICYAHACDV 72 A +VCLL+ L +CS CY C + Sbjct: 5 AISVCLLFLLSVCSACYISNCPI 27
>BLMH_RAT (P70645) Bleomycin hydrolase (EC 3.4.22.40) (BLM hydrolase) (BMH)| (BH) Length = 454 Score = 30.0 bits (66), Expect = 3.1 Identities = 10/16 (62%), Positives = 13/16 (81%) Frame = -2 Query: 421 WIIKNSWGENWGDKGY 374 W ++NSWGE+ G KGY Sbjct: 392 WRVENSWGEDHGHKGY 407
>PEPC_LACLC (Q04723) Aminopeptidase C (EC 3.4.22.40) (Bleomycin hydrolase)| Length = 435 Score = 29.6 bits (65), Expect = 4.1 Identities = 9/17 (52%), Positives = 14/17 (82%) Frame = -2 Query: 421 WIIKNSWGENWGDKGYY 371 W ++NSWG++ G KGY+ Sbjct: 373 WKVENSWGKDAGQKGYF 389
>PEPC_LACLA (Q9CEG3) Aminopeptidase C (EC 3.4.22.40) (Bleomycin hydrolase)| Length = 435 Score = 29.6 bits (65), Expect = 4.1 Identities = 9/17 (52%), Positives = 14/17 (82%) Frame = -2 Query: 421 WIIKNSWGENWGDKGYY 371 W ++NSWG++ G KGY+ Sbjct: 373 WKVENSWGKDAGQKGYF 389
>PEPC_LACHE (Q10744) Aminopeptidase C (EC 3.4.22.40) (Bleomycin hydrolase)| Length = 449 Score = 29.6 bits (65), Expect = 4.1 Identities = 11/17 (64%), Positives = 13/17 (76%) Frame = -2 Query: 421 WIIKNSWGENWGDKGYY 371 W I+NSWGE G KGY+ Sbjct: 381 WKIENSWGEKPGFKGYF 397
>RPGF6_HUMAN (Q8TEU7) Rap guanine nucleotide exchange factor 6 (PDZ| domain-containing guanine nucleotide exchange factor 2) (PDZ-GEF2) (RA-GEF-2) Length = 1601 Score = 29.3 bits (64), Expect = 5.3 Identities = 14/56 (25%), Positives = 27/56 (48%) Frame = -2 Query: 451 APSRFKEKPYWIIKNSWGENWGDKGYYKICRGSNVRNKCGVDSMVSTVSATHSSKE 284 +P K Y +I ++ +N D + +I S++ + C VDSM + + S + Sbjct: 1241 SPQGSPHKGYTLIPSAKSDNLSDSSHSEISSRSSIVSNCSVDSMSAALQDERCSSQ 1296
>PEPC_LISMO (O69192) Aminopeptidase C (EC 3.4.22.40) (Bleomycin hydrolase)| Length = 441 Score = 29.3 bits (64), Expect = 5.3 Identities = 9/17 (52%), Positives = 13/17 (76%) Frame = -2 Query: 421 WIIKNSWGENWGDKGYY 371 W ++NSWGE G+ GY+ Sbjct: 378 WKVENSWGEKIGNNGYF 394
>PEPC_LISIN (Q928V0) Aminopeptidase C (EC 3.4.22.40) (Bleomycin hydrolase)| Length = 441 Score = 29.3 bits (64), Expect = 5.3 Identities = 9/17 (52%), Positives = 13/17 (76%) Frame = -2 Query: 421 WIIKNSWGENWGDKGYY 371 W ++NSWGE G+ GY+ Sbjct: 378 WKVENSWGEKIGNNGYF 394
>PEPG_LACDL (P94869) Aminopeptidase G (EC 3.4.22.-)| Length = 437 Score = 28.9 bits (63), Expect = 6.9 Identities = 8/17 (47%), Positives = 14/17 (82%) Frame = -2 Query: 421 WIIKNSWGENWGDKGYY 371 W ++NSWG+ G+KG++ Sbjct: 378 WKVENSWGDKSGEKGFF 394
>PEPC_LACDL (Q48543) Aminopeptidase C (EC 3.4.22.40) (Bleomycin hydrolase)| Length = 449 Score = 28.9 bits (63), Expect = 6.9 Identities = 10/17 (58%), Positives = 13/17 (76%) Frame = -2 Query: 421 WIIKNSWGENWGDKGYY 371 W I+NSWG+ G KGY+ Sbjct: 381 WKIENSWGDKSGFKGYF 397
>MURB_CARHZ (Q3AAE8) UDP-N-acetylenolpyruvoylglucosamine reductase (EC| 1.1.1.158) (UDP-N-acetylmuramate dehydrogenase) Length = 302 Score = 28.9 bits (63), Expect = 6.9 Identities = 12/25 (48%), Positives = 16/25 (64%) Frame = -2 Query: 454 FAPSRFKEKPYWIIKNSWGENWGDK 380 + SRFKE+ WI+K + N GDK Sbjct: 175 YRSSRFKEEKQWIVKAEFSLNPGDK 199 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 55,516,232 Number of Sequences: 219361 Number of extensions: 941803 Number of successful extensions: 2605 Number of sequences better than 10.0: 196 Number of HSP's better than 10.0 without gapping: 2557 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2601 length of database: 80,573,946 effective HSP length: 103 effective length of database: 57,979,763 effective search space used: 3072927439 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)
