Clone Name | rbart39e08 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | TRPC_HELPY (O25867) Tryptophan biosynthesis protein trpCF [Inclu... | 28 | 5.0 |
---|
>TRPC_HELPY (O25867) Tryptophan biosynthesis protein trpCF [Includes:| Indole-3-glycerol phosphate synthase (EC 4.1.1.48) (IGPS); N-(5'-phospho-ribosyl)anthranilate isomerase (EC 5.3.1.24) (PRAI)] Length = 452 Score = 28.5 bits (62), Expect = 5.0 Identities = 15/38 (39%), Positives = 22/38 (57%) Frame = +3 Query: 18 FR*KLASMRQAATAMYNPNLLDQSNYLQVTNQAKLVQM 131 F+ KLA M A + ++LD NYL++ N AK + M Sbjct: 118 FQIKLARMMGANAVLLMLSVLDDKNYLELFNLAKSLNM 155 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 26,911,995 Number of Sequences: 219361 Number of extensions: 357767 Number of successful extensions: 873 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 867 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 873 length of database: 80,573,946 effective HSP length: 47 effective length of database: 70,263,979 effective search space used: 1686335496 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)