>CO8A_MOUSE (Q8K182) Complement component C8 alpha chain precursor (Complement|
           component 8 alpha subunit)
          Length = 587

 Score = 28.5 bits (62), Expect = 8.9
 Identities = 15/40 (37%), Positives = 20/40 (50%)
 Frame = +3

Query: 252 HGKSFITGSTSGITPIRSPCMRQFEATPSREKAKSITGSI 371
           +GKS   G T G+ P++SP     E T S  KA S    +
Sbjct: 242 NGKSHSAGVTVGVAPVKSPV--SIEVTGSGSKASSFLNKL 279


  Database: uniprot_sprot.fasta
    Posted date:  May 25, 2006  5:36 PM
  Number of letters in database: 80,573,946
  Number of sequences in database:  219,361
  
Lambda     K      H
   0.318    0.135    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 50,609,739
Number of Sequences: 219361
Number of extensions: 885274
Number of successful extensions: 2851
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 2711
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 2850
length of database: 80,573,946
effective HSP length: 102
effective length of database: 58,199,124
effective search space used: 3026354448
frameshift window, decay const: 50,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)