ナショナルバイオリソースプロジェクト
-Barley Genetic Resources Database-
menu 
| Clone Name | rbart39d09 |
|---|---|
| Clone Library Name | barley_pub |
>ZRP4_MAIZE (P47917) O-methyltransferase ZRP4 (EC 2.1.1.-) (OMT)| Length = 364 Score = 50.8 bits (120), Expect = 8e-07 Identities = 19/35 (54%), Positives = 28/35 (80%) Frame = -3 Query: 400 QRDETDWSEIFIKAGFSDYKVVKKLGARGVFEVYP 296 +RDE +WS+IF +AG+SDY+++ LG R + EVYP Sbjct: 330 ERDEQEWSKIFSEAGYSDYRIIPVLGVRSIIEVYP 364
>7OMT9_MEDSA (O22309) Isoflavone-7-O-methytransferase 9 (EC 2.1.1.150)| (Isoflavone-O-methytransferase 9) (7 IOMT-9) Length = 352 Score = 39.3 bits (90), Expect = 0.002 Identities = 14/36 (38%), Positives = 24/36 (66%) Frame = -3 Query: 403 RQRDETDWSEIFIKAGFSDYKVVKKLGARGVFEVYP 296 ++R+E +W ++FI+AGF YK+ G + E+YP Sbjct: 317 KERNEEEWKKLFIEAGFQHYKISPLTGFLSLIEIYP 352
>7OMT8_MEDSA (O24529) Isoflavone-7-O-methytransferase 8 (EC 2.1.1.150)| (Isoflavone-O-methytransferase 8) (7-IOMT-8) Length = 352 Score = 39.3 bits (90), Expect = 0.002 Identities = 14/36 (38%), Positives = 24/36 (66%) Frame = -3 Query: 403 RQRDETDWSEIFIKAGFSDYKVVKKLGARGVFEVYP 296 ++R+E +W ++FI+AGF YK+ G + E+YP Sbjct: 317 KERNEEEWKKLFIEAGFQHYKISPLTGFLSLIEIYP 352
>7OMT6_MEDSA (O22308) Isoflavone-7-O-methytransferase 6 (EC 2.1.1.150)| (Isoflavone-O-methytransferase 6) (7-IOMT-6) Length = 352 Score = 39.3 bits (90), Expect = 0.002 Identities = 14/36 (38%), Positives = 24/36 (66%) Frame = -3 Query: 403 RQRDETDWSEIFIKAGFSDYKVVKKLGARGVFEVYP 296 ++R+E +W ++FI+AGF YK+ G + E+YP Sbjct: 317 KERNEEEWKKLFIEAGFQHYKISPLTGFLSLIEIYP 352
>EOMT1_OCIBA (Q93WU2) Eugenol O-methyltransferase (EC 2.1.1.146) ((Iso)eugenol| O-methyltransferase EOMT1) (S-adenosysl-L-methionine:(Iso)eugenol O-methyltransferase EOMT1) Length = 357 Score = 35.0 bits (79), Expect = 0.043 Identities = 12/36 (33%), Positives = 20/36 (55%) Frame = -3 Query: 403 RQRDETDWSEIFIKAGFSDYKVVKKLGARGVFEVYP 296 ++R ++W ++ AGF YK+ G R + E YP Sbjct: 322 KERTMSEWEKLIYDAGFKSYKLTPAFGVRSLIEAYP 357
>CVMT1_OCIBA (Q93WU3) Chavicol O-methyltransferase (EC 2.1.1.146) ((Iso)eugenol| O-methyltransferase CVOMT1) (S-adenosysl-L-methionine:(Iso)eugenol O-methyltransferase CVOMT1) Length = 356 Score = 34.7 bits (78), Expect = 0.056 Identities = 12/36 (33%), Positives = 20/36 (55%) Frame = -3 Query: 403 RQRDETDWSEIFIKAGFSDYKVVKKLGARGVFEVYP 296 ++R +W ++ AGF+ YK+ G R + E YP Sbjct: 321 KERTMNEWEKLISAAGFTSYKLTPAFGVRSLIEAYP 356
>6OMT_COPJA (Q9LEL6) (RS)-norcoclaurine 6-O-methyltransferase (EC 2.1.1.128)| (S-adenosyl-L-methionine:norcoclaurine 6-O-methyltransferase) (6-OMT) Length = 347 Score = 30.4 bits (67), Expect = 1.1 Identities = 10/36 (27%), Positives = 20/36 (55%) Frame = -3 Query: 403 RQRDETDWSEIFIKAGFSDYKVVKKLGARGVFEVYP 296 ++R E +W ++ AG+ +K+ + + V E YP Sbjct: 311 KERTEEEWKKLIHDAGYKGHKITQITAVQSVIEAYP 346
>AMPA_PROMA (Q7VAP4) Probable cytosol aminopeptidase (EC 3.4.11.1) (Leucine| aminopeptidase) (LAP) (Leucyl aminopeptidase) Length = 496 Score = 28.5 bits (62), Expect = 4.0 Identities = 16/40 (40%), Positives = 22/40 (55%) Frame = -2 Query: 239 IVLRPRQLIRIGGSIIICGLLQGMCSMEIVLLSQICLEDN 120 I L + L GSII GLL+G ++ LL +IC D+ Sbjct: 3 ISLYQKNLADWTGSIIAVGLLEGQIQEQLSLLEEICDYDS 42
>CCPR_ASPFU (Q4WPF8) Cytochrome c peroxidase, mitochondrial precursor (EC| 1.11.1.5) (CCP) Length = 366 Score = 28.1 bits (61), Expect = 5.2 Identities = 11/38 (28%), Positives = 22/38 (57%) Frame = -3 Query: 397 RDETDWSEIFIKAGFSDYKVVKKLGARGVFEVYP*ETG 284 +D+ +IF + GF+D ++V +GA + +P +G Sbjct: 224 KDQRHIRDIFYRMGFNDQEIVALIGAHALGRAHPDRSG 261
>RBS_SYNY3 (P54206) Ribulose bisphosphate carboxylase small chain (EC| 4.1.1.39) (RuBisCO small subunit) Length = 113 Score = 28.1 bits (61), Expect = 5.2 Identities = 13/40 (32%), Positives = 20/40 (50%) Frame = -3 Query: 163 LWKLSYFPRYVWRIILYEVRWGVMHNMGCYALLVTFQSVK 44 +WKL +F +L EVR N CY ++ F ++K Sbjct: 55 MWKLPFFGGATANEVLAEVRECRSENPNCYIRVIGFDNIK 94
>NFKB2_MOUSE (Q9WTK5) Nuclear factor NF-kappa-B p100 subunit (DNA-binding factor| KBF2) [Contains: Nuclear factor NF-kappa-B p52 subunit] Length = 899 Score = 27.7 bits (60), Expect = 6.8 Identities = 12/38 (31%), Positives = 21/38 (55%) Frame = -1 Query: 345 IKL*RN*ELEVSLRSTRERQDQKYGSELIEANSIQYCP 232 ++L + E L ST ++D YGS+ +E + + CP Sbjct: 844 VRLLKGPETRDKLPSTEVKEDSAYGSQSVEQEAEKLCP 881
>RPM1_ARATH (Q39214) Disease resistance protein RPM1 (Resistance to Pseudomonas| syringae protein 3) Length = 926 Score = 27.7 bits (60), Expect = 6.8 Identities = 9/18 (50%), Positives = 14/18 (77%), Gaps = 1/18 (5%) Frame = -3 Query: 178 FRGCA-LWKLSYFPRYVW 128 +R CA +W+ +FPRY+W Sbjct: 92 YRSCAKIWRAFHFPRYMW 109
>SYV_CLOTE (Q891R5) Valyl-tRNA synthetase (EC 6.1.1.9) (Valine--tRNA ligase)| (ValRS) Length = 880 Score = 27.3 bits (59), Expect = 8.9 Identities = 12/38 (31%), Positives = 20/38 (52%) Frame = +2 Query: 35 E*KFYRLESNQEGITPHIMHNTPSYLVQYYPPNISGKV 148 E + Y++ E TP + + Y + PPNI+GK+ Sbjct: 17 EERIYKMWEEGEYFTPKVDKDKKPYTIVMPPPNITGKL 54
>SYV_CLOAB (Q97GG8) Valyl-tRNA synthetase (EC 6.1.1.9) (Valine--tRNA ligase)| (ValRS) Length = 881 Score = 27.3 bits (59), Expect = 8.9 Identities = 12/38 (31%), Positives = 19/38 (50%) Frame = +2 Query: 35 E*KFYRLESNQEGITPHIMHNTPSYLVQYYPPNISGKV 148 E + Y+ + TP + N Y + PPNI+GK+ Sbjct: 17 EDRIYKWWEEEGFFTPKVDKNKKPYTIMMPPPNITGKL 54 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 61,242,764 Number of Sequences: 219361 Number of extensions: 1225676 Number of successful extensions: 2596 Number of sequences better than 10.0: 14 Number of HSP's better than 10.0 without gapping: 2569 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2596 length of database: 80,573,946 effective HSP length: 110 effective length of database: 56,444,236 effective search space used: 1354661664 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)
