Clone Name | rbart39c12 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | PSD4_ARATH (P55034) 26S proteasome non-ATPase regulatory subunit... | 50 | 3e-06 | 2 | PSD4_HUMAN (P55036) 26S proteasome non-ATPase regulatory subunit... | 40 | 0.003 | 3 | PSD4_DROME (P55035) 26S proteasome non-ATPase regulatory subunit... | 39 | 0.007 | 4 | PSD4_MOUSE (O35226) 26S proteasome non-ATPase regulatory subunit... | 38 | 0.015 | 5 | PSD4_SCHMA (O17453) 26S proteasome non-ATPase regulatory subunit... | 29 | 9.0 |
---|
>PSD4_ARATH (P55034) 26S proteasome non-ATPase regulatory subunit 4 (26S| proteasome regulatory subunit S5A) (Multiubiquitin chain-binding protein) Length = 386 Score = 50.4 bits (119), Expect = 3e-06 Identities = 23/45 (51%), Positives = 37/45 (82%) Frame = -3 Query: 409 QDAEASGQSDMSKVFEDRSFVTSILNSLPGVDPNDPSVKDLLASL 275 + +EA+G + + +++F++S+L+SLPGVDPNDP+VK+LLASL Sbjct: 322 ESSEATGAGN--NLLGNQAFISSVLSSLPGVDPNDPAVKELLASL 364
>PSD4_HUMAN (P55036) 26S proteasome non-ATPase regulatory subunit 4 (26S| proteasome regulatory subunit S5A) (Rpn10) (Multiubiquitin chain-binding protein) (Antisecretory factor 1) (AF) (ASF) Length = 377 Score = 40.4 bits (93), Expect = 0.003 Identities = 17/46 (36%), Positives = 30/46 (65%) Frame = -3 Query: 403 AEASGQSDMSKVFEDRSFVTSILNSLPGVDPNDPSVKDLLASLHGQ 266 +E + + D V +D F+ S+L +LPGVDPN+ ++++ + SL Q Sbjct: 317 SEPAKEEDDYDVMQDPEFLQSVLENLPGVDPNNEAIRNAMGSLASQ 362
>PSD4_DROME (P55035) 26S proteasome non-ATPase regulatory subunit 4 (26S| proteasome regulatory subunit S5A) (Multiubiquitin chain-binding protein) (54 kDa subunit of mu particle) (p54) Length = 396 Score = 39.3 bits (90), Expect = 0.007 Identities = 17/37 (45%), Positives = 26/37 (70%) Frame = -3 Query: 382 DMSKVFEDRSFVTSILNSLPGVDPNDPSVKDLLASLH 272 D S+V D +F+ S+L +LPGVDP +V+D + SL+ Sbjct: 345 DYSEVIGDPAFLQSVLENLPGVDPQSEAVRDAVGSLN 381
>PSD4_MOUSE (O35226) 26S proteasome non-ATPase regulatory subunit 4 (26S| proteasome regulatory subunit S5A) (Rpn10) (Multiubiquitin chain-binding protein) Length = 376 Score = 38.1 bits (87), Expect = 0.015 Identities = 15/41 (36%), Positives = 27/41 (65%) Frame = -3 Query: 388 QSDMSKVFEDRSFVTSILNSLPGVDPNDPSVKDLLASLHGQ 266 + D V +D F+ S+L +LPGVDPN+ +++ ++ +L Q Sbjct: 321 EEDDYDVMQDPEFLQSVLENLPGVDPNNAAIRSVMGALASQ 361
>PSD4_SCHMA (O17453) 26S proteasome non-ATPase regulatory subunit 4 (26S| proteasome regulatory subunit S5A) Length = 420 Score = 28.9 bits (63), Expect = 9.0 Identities = 13/32 (40%), Positives = 19/32 (59%) Frame = -3 Query: 370 VFEDRSFVTSILNSLPGVDPNDPSVKDLLASL 275 V D F+ S+L SLPGVD + V+ + +L Sbjct: 367 VMYDAEFLESVLQSLPGVDTQNEDVRKAINAL 398 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 56,121,012 Number of Sequences: 219361 Number of extensions: 896001 Number of successful extensions: 1970 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 1918 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1970 length of database: 80,573,946 effective HSP length: 104 effective length of database: 57,760,402 effective search space used: 3985467738 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)