Clone Name | rbart39c03 |
---|---|
Clone Library Name | barley_pub |
>NRG3_HUMAN (P56975) Pro-neuregulin-3, membrane-bound isoform precursor| (Pro-NRG3) [Contains: Neuregulin-3 (NRG-3)] Length = 720 Score = 28.5 bits (62), Expect = 4.6 Identities = 23/65 (35%), Positives = 28/65 (43%) Frame = +1 Query: 1 TRIMTPCTNVQI*IRASS*LGLATSVTPVPYPIPQKNIFF*QKSSNFAIRPSCEGSPLLQ 180 TR T ++ IRAS A + T P +P F SS RP G+P Q Sbjct: 162 TRAPTRFPGHRVPIRASPRSTTARN-TAAPATVPSTTAPF-FSSSTLGSRPPVPGTPSTQ 219 Query: 181 AMPVW 195 AMP W Sbjct: 220 AMPSW 224
>MTNN_TREPA (P96122) MTA/SAH nucleosidase (EC 3.2.2.9) (5'-methylthioadenosine| nucleosidase) (S-adenosylhomocysteine nucleosidase) Length = 269 Score = 28.5 bits (62), Expect = 4.6 Identities = 13/35 (37%), Positives = 17/35 (48%) Frame = +3 Query: 177 TSNARLGIAAPD*FSLCDRRPSWTDATQCKMMGDG 281 T+N L + F LC R P WT+ C + G G Sbjct: 120 TANTALRYLVREAFDLCTRDPEWTEGA-CALSGSG 153
>Y1566_ARCFU (O28706) Hypothetical protein AF1566| Length = 263 Score = 28.5 bits (62), Expect = 4.6 Identities = 15/40 (37%), Positives = 21/40 (52%) Frame = +3 Query: 171 ATTSNARLGIAAPD*FSLCDRRPSWTDATQCKMMGDGWVN 290 A + RLG A+PD F WT QC ++GD +V+ Sbjct: 129 ALPDDIRLGYASPDGFGYS----VWTFIIQCSVLGDEYVD 164
>NRG3_MOUSE (O35181) Pro-neuregulin-3, membrane-bound isoform precursor| (Pro-NRG3) [Contains: Neuregulin-3 (NRG-3)] Length = 713 Score = 27.7 bits (60), Expect = 7.8 Identities = 22/65 (33%), Positives = 27/65 (41%) Frame = +1 Query: 1 TRIMTPCTNVQI*IRASS*LGLATSVTPVPYPIPQKNIFF*QKSSNFAIRPSCEGSPLLQ 180 TR T ++ IRAS A + P + FF SS RP G+P Q Sbjct: 162 TRAPTRFPGHRVPIRASPRSTTARNTAAPPTVLSTTAPFF--SSSTPGSRPPMPGAPSTQ 219 Query: 181 AMPVW 195 AMP W Sbjct: 220 AMPSW 224
>CHSG_PETHY (P22927) Chalcone synthase G (EC 2.3.1.74) (Naringenin-chalcone| synthase G) Length = 393 Score = 27.7 bits (60), Expect = 7.8 Identities = 18/67 (26%), Positives = 31/67 (46%) Frame = +3 Query: 12 DTMYQCTNMNQSVQLIRLSDISHSCSVSYTAKKYIFLTEILKFRHPPKLRGEPATTSNAR 191 D +++ T + +L H C S K+Y+ LTE + ++ P + A + NAR Sbjct: 38 DFLFRITTSDHKTEL--KEKFKHMCEGSMIKKRYLHLTEEI-LKNNPNICEHKAPSLNAR 94 Query: 192 LGIAAPD 212 IA + Sbjct: 95 QEIAVAE 101 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 43,910,537 Number of Sequences: 219361 Number of extensions: 827784 Number of successful extensions: 1849 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 1835 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1848 length of database: 80,573,946 effective HSP length: 73 effective length of database: 64,560,593 effective search space used: 1549454232 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)