Clone Name | rbart38g09 |
---|---|
Clone Library Name | barley_pub |
>RHGA_ASPAC (Q00001) Rhamnogalacturonase A precursor (EC 3.2.1.-) (RGase A)| (RHG A) Length = 440 Score = 43.9 bits (102), Expect = 2e-04 Identities = 25/84 (29%), Positives = 38/84 (45%), Gaps = 4/84 (4%) Frame = -2 Query: 490 IKLACSDAVPCSDIVLSNINLLGDDGAEVQAVCNCAMGLGYDPVRPAVDCLRNNACXXXX 311 I++ CSD PC+D+ L +I + + G+ +C A G GY CL++++ Sbjct: 336 IRVVCSDTAPCTDLTLEDIAIWTESGSSELYLCRSAYGSGY--------CLKDSSSHTSY 387 Query: 310 XXXXXXXXEPS----TTTAAPLHT 251 PS TT AA L T Sbjct: 388 TTTSTVTAAPSGYSATTMAADLAT 411
>PGLR2_JUNAS (Q9FY19) Polygalacturonase precursor (PG) (EC 3.2.1.15) (Pectinase)| (Major pollen allergen Jun a 2) Length = 507 Score = 39.3 bits (90), Expect = 0.006 Identities = 22/52 (42%), Positives = 29/52 (55%) Frame = -2 Query: 493 AIKLACSDAVPCSDIVLSNINLLGDDGAEVQAVCNCAMGLGYDPVRPAVDCL 338 AI+L CSD+VPCS+I LSN+ L G V A G +P+ P+ L Sbjct: 380 AIQLMCSDSVPCSNIKLSNVFLKLTSGKVATCVNKNANGYYTNPLNPSCKSL 431
>PGLR_LYCES (P05117) Polygalacturonase-2 precursor (EC 3.2.1.15) (PG) (PG-2A)| (PG-2B) (Pectinase) Length = 457 Score = 39.3 bits (90), Expect = 0.006 Identities = 16/34 (47%), Positives = 21/34 (61%) Frame = -2 Query: 493 AIKLACSDAVPCSDIVLSNINLLGDDGAEVQAVC 392 AIK CS PC I++ NINL+G+ G +A C Sbjct: 394 AIKFDCSTNFPCEGIIMENINLVGESGKPSEATC 427
>PGLR2_ARATH (P49063) Exopolygalacturonase clone GBGA483 precursor (EC 3.2.1.67)| (ExoPG) (Pectinase) (Galacturan 1,4-alpha-galacturonidase) Length = 444 Score = 38.1 bits (87), Expect = 0.013 Identities = 19/37 (51%), Positives = 25/37 (67%), Gaps = 2/37 (5%) Frame = -2 Query: 493 AIKLACSDAVPCSDIVLSNINLL--GDDGAEVQAVCN 389 A+KL CS VPC++I LS+INL+ G +G V A N Sbjct: 386 AVKLMCSKGVPCTNIALSDINLVHNGKEGPAVSACSN 422
>PGLR_PERAE (Q02096) Polygalacturonase precursor (EC 3.2.1.15) (PG) (Pectinase)| Length = 462 Score = 37.0 bits (84), Expect = 0.029 Identities = 17/41 (41%), Positives = 23/41 (56%), Gaps = 1/41 (2%) Frame = -2 Query: 493 AIKLACSDAVPCSDIVLSNINLLGDDGAEVQAVC-NCAMGL 374 A+K CS + PC ++ NINL+G+ G E C N GL Sbjct: 402 AVKFDCSKSSPCQGYIVGNINLVGNGGKETTMSCSNIVQGL 442
>PGLR2_CHAOB (Q7M1E7) Polygalacturonase precursor (PG) (EC 3.2.1.15) (Pectinase)| (Major pollen allergen Cha o 2) Length = 514 Score = 35.8 bits (81), Expect = 0.065 Identities = 21/53 (39%), Positives = 27/53 (50%) Frame = -2 Query: 493 AIKLACSDAVPCSDIVLSNINLLGDDGAEVQAVCNCAMGLGYDPVRPAVDCLR 335 AI+L CSD+VPC+ I LSN++L G V A G + P LR Sbjct: 379 AIQLMCSDSVPCTGIQLSNVSLKLTSGKPASCVDKNARGFYSGRLIPTCKNLR 431
>PGLR2_CRYJA (P43212) Polygalacturonase precursor (EC 3.2.1.15) (PG) (Pectinase)| (Major pollen allergen Cry j 2) (Cry j II) Length = 514 Score = 34.7 bits (78), Expect = 0.14 Identities = 22/56 (39%), Positives = 30/56 (53%) Frame = -2 Query: 493 AIKLACSDAVPCSDIVLSNINLLGDDGAEVQAVCNCAMGLGYDPVRPAVDCLRNNA 326 AI+L CSD++PC DI LS+I+L G + + A G V PA L +A Sbjct: 379 AIQLKCSDSMPCKDIKLSDISLKLTSGKIASCLNDNANGYFSGHVIPACKNLSPSA 434
>PGLR_ACTCH (P35336) Polygalacturonase precursor (EC 3.2.1.15) (PG) (Pectinase)| Length = 467 Score = 33.5 bits (75), Expect = 0.32 Identities = 15/35 (42%), Positives = 21/35 (60%) Frame = -2 Query: 493 AIKLACSDAVPCSDIVLSNINLLGDDGAEVQAVCN 389 AI CS PC IVL +++L + GA +A+CN Sbjct: 407 AITFDCSKRFPCQGIVLEDVDLEIEGGAAAKALCN 441
>PGLR3_MAIZE (P35339) Exopolygalacturonase precursor (EC 3.2.1.67) (ExoPG)| (Pectinase) (Galacturan 1,4-alpha-galacturonidase) Length = 410 Score = 32.3 bits (72), Expect = 0.72 Identities = 17/59 (28%), Positives = 28/59 (47%), Gaps = 1/59 (1%) Frame = -2 Query: 496 EAIKLACSDAVPCSDIVLSNINL-LGDDGAEVQAVCNCAMGLGYDPVRPAVDCLRNNAC 323 EA+ L C+ +PC+ + + ++N+ + AVC A G A CL+ AC Sbjct: 358 EAVNLLCTAKIPCTGVTMDDVNIKYSGTNNKTMAVCKNAKG-------SAKGCLKELAC 409
>PGLR_OENOR (P24548) Exopolygalacturonase (EC 3.2.1.67) (ExoPG) (Pectinase)| (Galacturan 1,4-alpha-galacturonidase) (Fragment) Length = 362 Score = 30.8 bits (68), Expect = 2.1 Identities = 14/36 (38%), Positives = 22/36 (61%), Gaps = 1/36 (2%) Frame = -2 Query: 496 EAIKLACSDAVPCSDIVLSNINL-LGDDGAEVQAVC 392 EA+KL CS + PC+ + L++I+L G +VC Sbjct: 303 EAVKLVCSKSFPCNGVELADIDLTYSGKGGPATSVC 338
>PGLR_MEDSA (Q40312) Polygalacturonase precursor (EC 3.2.1.15) (PG) (Pectinase)| Length = 421 Score = 30.8 bits (68), Expect = 2.1 Identities = 15/35 (42%), Positives = 21/35 (60%) Frame = -2 Query: 496 EAIKLACSDAVPCSDIVLSNINLLGDDGAEVQAVC 392 E + L CS AVPC + L+N++ L +GA A C Sbjct: 344 EGVVLICSSAVPCDGVELNNVD-LKFNGAPTTAKC 377
>PGLR1_MAIZE (P26216) Exopolygalacturonase precursor (EC 3.2.1.67) (ExoPG)| (Pectinase) (Galacturan 1,4-alpha-galacturonidase) Length = 410 Score = 30.4 bits (67), Expect = 2.7 Identities = 16/59 (27%), Positives = 27/59 (45%), Gaps = 1/59 (1%) Frame = -2 Query: 496 EAIKLACSDAVPCSDIVLSNINL-LGDDGAEVQAVCNCAMGLGYDPVRPAVDCLRNNAC 323 EA+ L C+ VPC+ + + ++N+ + A+C A G CL+ AC Sbjct: 358 EAVSLLCTAKVPCTGVTMDDVNVEYSGTNNKTMAICTNAKG-------STKGCLKELAC 409
>SRF_XENLA (P23790) Serum response factor (SRF)| Length = 448 Score = 30.0 bits (66), Expect = 3.6 Identities = 17/42 (40%), Positives = 25/42 (59%) Frame = +3 Query: 372 PSPMAQLHTACTSAPSSPSRLMLLSTMSLHGTASLQASLMAS 497 P Q+H+A ++PSS S L+ T S GT +L A++M S Sbjct: 301 PVQAIQVHSAAQASPSSDSSSELVQTSS-SGTVTLPAAIMTS 341
>PGLR2_MAIZE (P35338) Exopolygalacturonase precursor (EC 3.2.1.67) (ExoPG)| (Pectinase) (Galacturan 1,4-alpha-galacturonidase) Length = 410 Score = 29.3 bits (64), Expect = 6.1 Identities = 17/59 (28%), Positives = 26/59 (44%), Gaps = 1/59 (1%) Frame = -2 Query: 496 EAIKLACSDAVPCSDIVLSNINL-LGDDGAEVQAVCNCAMGLGYDPVRPAVDCLRNNAC 323 EAI L C+ VPC+ + ++N+ + A+C A G CL+ AC Sbjct: 358 EAISLLCTAKVPCTGATMDDVNVEYSGTNNKTMAICTNAKG-------STKGCLKELAC 409
>PGLR_MALDO (P48978) Polygalacturonase precursor (EC 3.2.1.15) (PG) (Pectinase)| Length = 460 Score = 29.3 bits (64), Expect = 6.1 Identities = 12/23 (52%), Positives = 16/23 (69%) Frame = -2 Query: 496 EAIKLACSDAVPCSDIVLSNINL 428 +AI L CS +VPC IVL ++ L Sbjct: 416 DAITLNCSQSVPCQGIVLQSVQL 438 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 48,225,943 Number of Sequences: 219361 Number of extensions: 781970 Number of successful extensions: 2175 Number of sequences better than 10.0: 15 Number of HSP's better than 10.0 without gapping: 2134 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2175 length of database: 80,573,946 effective HSP length: 104 effective length of database: 57,760,402 effective search space used: 3523384522 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)