| Clone Name | rbart38f06 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | IF3X_HUMAN (O75153) Putative eukaryotic translation initiation f... | 28 | 9.9 | 2 | CLCA_ARATH (P92941) Chloride channel protein CLC-a (AtCLC-a) | 28 | 9.9 |
|---|
>IF3X_HUMAN (O75153) Putative eukaryotic translation initiation factor 3| subunit (eIF-3) Length = 1309 Score = 28.5 bits (62), Expect = 9.9 Identities = 14/31 (45%), Positives = 20/31 (64%) Frame = +1 Query: 154 QIHAQHARTQLVSIDPSVSWTMNDPPSLNFL 246 +IH +H R L S+DPS ++ D SL+FL Sbjct: 129 RIHVRHVRDLLKSLDPSDAFNGVDCNSLSFL 159
>CLCA_ARATH (P92941) Chloride channel protein CLC-a (AtCLC-a)| Length = 775 Score = 28.5 bits (62), Expect = 9.9 Identities = 17/42 (40%), Positives = 22/42 (52%) Frame = +1 Query: 10 NSGTSRNLITS*AHLNRVRKEREQKWTFNNKRRRSEEEAASK 135 N+GT + + AHL +V K+R W N KRR E E K Sbjct: 632 NTGTELHGLILRAHLVKVLKKR---WFLNEKRRTEEWEVREK 670 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 46,982,532 Number of Sequences: 219361 Number of extensions: 638824 Number of successful extensions: 1816 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 1748 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1815 length of database: 80,573,946 effective HSP length: 103 effective length of database: 57,979,763 effective search space used: 3362826254 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)