| Clone Name | rbart38c10 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | AMPA_MYCSA (P47707) Probable cytosol aminopeptidase (EC 3.4.11.1... | 33 | 0.36 | 2 | SC24A_ARATH (Q9SFU0) Protein transport protein Sec24-like At3g07100 | 30 | 3.0 | 3 | WIF1_DROME (Q9W3W5) Protein shifted precursor (WIF-1-like protein) | 29 | 5.1 | 4 | YS56_CAEEL (Q09378) Hypothetical protein ZK673.6 | 29 | 6.7 |
|---|
>AMPA_MYCSA (P47707) Probable cytosol aminopeptidase (EC 3.4.11.1) (Leucine| aminopeptidase) (LAP) (Leucyl aminopeptidase) Length = 520 Score = 33.1 bits (74), Expect = 0.36 Identities = 18/47 (38%), Positives = 29/47 (61%), Gaps = 4/47 (8%) Frame = +2 Query: 56 HKEQSCSNLNQHTRTLKS-CTSAAIYTRQMT---PYIHMPVAGSWSK 184 +KE ++LN ++ KS C +AA++ ++ T PYIH VAG+ K Sbjct: 393 NKESLVADLNNYSNNEKSDCNTAAMFLKEFTNNVPYIHCDVAGTADK 439
>SC24A_ARATH (Q9SFU0) Protein transport protein Sec24-like At3g07100| Length = 1038 Score = 30.0 bits (66), Expect = 3.0 Identities = 22/87 (25%), Positives = 38/87 (43%), Gaps = 8/87 (9%) Frame = +2 Query: 80 LNQHTRTLKSCTSAAIYTRQMTPYIHMPVAGSWSKIKWDKMNDAIP------NYIYKC-- 235 +N H+R L+ TSA ++ + H+P+ + + +P I +C Sbjct: 314 MNCHSRYLRLTTSAIPNSQSLASRWHLPLGAVVCPLAETPEGEEVPLIDFGSTGIIRCRR 373 Query: 236 CRKLVNKNECVFYDAQRSWSCSALALL 316 CR VN F D+ R W C+ ++L Sbjct: 374 CRTYVNP-FVTFTDSGRKWRCNICSML 399
>WIF1_DROME (Q9W3W5) Protein shifted precursor (WIF-1-like protein)| Length = 456 Score = 29.3 bits (64), Expect = 5.1 Identities = 14/40 (35%), Positives = 19/40 (47%) Frame = -3 Query: 377 KQHRTWVCPSGGFKANFTHCKARPMLNKTSCAARRRRHIH 258 KQ C +G ++ HCK P C R+RRH+H Sbjct: 411 KQRSICKCRNGTCVSH-KHCKCHPGFYGRHCNGRKRRHVH 449
>YS56_CAEEL (Q09378) Hypothetical protein ZK673.6| Length = 284 Score = 28.9 bits (63), Expect = 6.7 Identities = 13/32 (40%), Positives = 20/32 (62%) Frame = +2 Query: 182 KIKWDKMNDAIPNYIYKCCRKLVNKNECVFYD 277 K+++ K N+A N I + C K+ +K E FYD Sbjct: 104 KVEFIKKNEAEANMIAELCEKMGHKEEQHFYD 135 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 59,480,870 Number of Sequences: 219361 Number of extensions: 1136710 Number of successful extensions: 2525 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 2477 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2525 length of database: 80,573,946 effective HSP length: 102 effective length of database: 58,199,124 effective search space used: 2968155324 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)