| Clone Name | rbart38b06 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | MYO1_SCHPO (Q9Y7Z8) Myosin-1 | 33 | 0.31 | 2 | MRC2_HUMAN (Q9UBG0) Macrophage mannose receptor 2 precursor (Uro... | 30 | 2.7 | 3 | ARHGB_RAT (Q9ES67) Rho guanine nucleotide exchange factor 11 (Rh... | 30 | 2.7 | 4 | NAC3_RAT (P70549) Sodium/calcium exchanger 3 precursor (Na(+)/Ca... | 30 | 3.5 | 5 | NAC3_HUMAN (P57103) Sodium/calcium exchanger 3 precursor (Na(+)/... | 30 | 4.5 | 6 | Y2989_METCA (Q602S2) UPF0078 membrane protein MCA2989 | 29 | 7.7 |
|---|
>MYO1_SCHPO (Q9Y7Z8) Myosin-1| Length = 1217 Score = 33.5 bits (75), Expect = 0.31 Identities = 26/77 (33%), Positives = 35/77 (45%) Frame = +3 Query: 246 RTA*TKPKSNPSATLLPAHVLASVCTGERTAARAPVTAMYSTTCHFFPFASLHALPNAAA 425 + A TKP S P+A PA + V T ++T R P AM A PN Sbjct: 993 KPAATKPVSMPAAKSKPAPMANPVSTAQQTQNRPPAPAM-------------QARPNTTQ 1039 Query: 426 PWQPGSATATTTLKEQT 476 P ++T TTT+K+ T Sbjct: 1040 AAAPVTST-TTTIKQAT 1055
>MRC2_HUMAN (Q9UBG0) Macrophage mannose receptor 2 precursor (Urokinase| receptor-associated protein) (Endocytic receptor 180) (CD280 antigen) Length = 1479 Score = 30.4 bits (67), Expect = 2.7 Identities = 17/45 (37%), Positives = 25/45 (55%), Gaps = 1/45 (2%) Frame = -2 Query: 250 VLMALLQLFALCAMTAFYYERRENMD-GQLGATRYAKLSSEESNA 119 VLMA+L L AL Y RR++++ G RY++ SS + A Sbjct: 1418 VLMAVLLLLALLTAALILYRRRQSIERGAFEGARYSRSSSSPTEA 1462
>ARHGB_RAT (Q9ES67) Rho guanine nucleotide exchange factor 11 (RhoGEF glutamate| transport modulator GTRAP48) Length = 1527 Score = 30.4 bits (67), Expect = 2.7 Identities = 17/65 (26%), Positives = 25/65 (38%) Frame = +3 Query: 285 TLLPAHVLASVCTGERTAARAPVTAMYSTTCHFFPFASLHALPNAAAPWQPGSATATTTL 464 +LLP H + + GE P ++ S T H PW PGS T+ Sbjct: 1221 SLLPGHTVKTQAAGEPEDDLTPTPSVVSITSH---------------PWDPGSPGQAPTI 1265 Query: 465 KEQTK 479 + T+ Sbjct: 1266 SDSTR 1270
>NAC3_RAT (P70549) Sodium/calcium exchanger 3 precursor| (Na(+)/Ca(2+)-exchange protein 3) Length = 927 Score = 30.0 bits (66), Expect = 3.5 Identities = 13/40 (32%), Positives = 22/40 (55%) Frame = -2 Query: 253 AVLMALLQLFALCAMTAFYYERRENMDGQLGATRYAKLSS 134 A + L +FA ++ Y RR ++ G+LG R KL++ Sbjct: 862 AFSVTLFTIFAFVCLSVLLYRRRPHLGGELGGPRGCKLAT 901
>NAC3_HUMAN (P57103) Sodium/calcium exchanger 3 precursor| (Na(+)/Ca(2+)-exchange protein 3) Length = 927 Score = 29.6 bits (65), Expect = 4.5 Identities = 13/40 (32%), Positives = 22/40 (55%) Frame = -2 Query: 253 AVLMALLQLFALCAMTAFYYERRENMDGQLGATRYAKLSS 134 A + L +FA ++ Y RR ++ G+LG R KL++ Sbjct: 862 AFSVTLFTIFAFVCISVLLYRRRPHLGGELGGPRGCKLAT 901
>Y2989_METCA (Q602S2) UPF0078 membrane protein MCA2989| Length = 198 Score = 28.9 bits (63), Expect = 7.7 Identities = 20/50 (40%), Positives = 26/50 (52%), Gaps = 1/50 (2%) Frame = -2 Query: 346 ALAAVLSPVHTLARTCAGNSVALGLLLGFVYAV-LMALLQLFALCAMTAF 200 A L PV + G + ALG+LLGF + V LMALL + A+ F Sbjct: 89 AFVGHLYPVFFQFKGGKGVATALGVLLGFAWPVGLMALLTWIGVAALFRF 138 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 60,126,528 Number of Sequences: 219361 Number of extensions: 1110170 Number of successful extensions: 3395 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 3303 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3394 length of database: 80,573,946 effective HSP length: 103 effective length of database: 57,979,763 effective search space used: 3420806017 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)