Clone Name | rbart38a07 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | VL2_HPV67 (O90729) Minor capsid protein L2 | 29 | 9.3 | 2 | COX1_STRPU (P15544) Cytochrome c oxidase subunit 1 (EC 1.9.3.1) ... | 29 | 9.3 |
---|
>VL2_HPV67 (O90729) Minor capsid protein L2| Length = 465 Score = 28.9 bits (63), Expect = 9.3 Identities = 21/75 (28%), Positives = 34/75 (45%) Frame = -1 Query: 527 TGKEAGNEANYIVGMSSCYPKPGSIKVSDGEVLTIVSNYSSTREHTGVMGLVYILVAEPQ 348 +GK+ G +Y +S P +D L +S S+ H+ GL Y + +P Sbjct: 314 SGKQIGARVHYYQDLSPIVP-------ADSIELQPLSRPVSSASHSINDGL-YDVYMDPD 365 Query: 347 QPAPAPSLCFSFPAP 303 P P PS+ +S +P Sbjct: 366 TPFPQPSISYSLHSP 380
>COX1_STRPU (P15544) Cytochrome c oxidase subunit 1 (EC 1.9.3.1) (Cytochrome c| oxidase polypeptide I) Length = 517 Score = 28.9 bits (63), Expect = 9.3 Identities = 11/28 (39%), Positives = 19/28 (67%) Frame = -1 Query: 440 GEVLTIVSNYSSTREHTGVMGLVYILVA 357 G + ++++YS RE G +GLVY ++A Sbjct: 252 GMISHVIAHYSGKREPFGYLGLVYAMIA 279 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 64,455,710 Number of Sequences: 219361 Number of extensions: 1186198 Number of successful extensions: 2617 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2570 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2616 length of database: 80,573,946 effective HSP length: 105 effective length of database: 57,541,041 effective search space used: 4142954952 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)