| Clone Name | rbart37h11 |
|---|---|
| Clone Library Name | barley_pub |
>HOMEZ_HUMAN (Q8IX15) Homeobox and leucine zipper protein Homez (Homeodomain| leucine zipper-containing factor) Length = 525 Score = 30.0 bits (66), Expect = 1.4 Identities = 13/33 (39%), Positives = 22/33 (66%), Gaps = 1/33 (3%) Frame = +1 Query: 205 DMTLFCI-YGMEGEKIQDNTTSRRTRAGTSWTS 300 D+ L C+ YG++ EK++ ++R R G SW+S Sbjct: 60 DIALLCLRYGLQMEKVKTWFMAQRLRCGISWSS 92
>XRN1_YEAST (P22147) 5'-3' exoribonuclease 1 (EC 3.1.11.-) (Strand exchange| protein 1) (KAR(-)-enhancing mutation protein) (5'-3' exoribonuclease) (DNA strand transfer protein beta) (STP-beta) (p175) Length = 1528 Score = 29.3 bits (64), Expect = 2.5 Identities = 11/27 (40%), Positives = 19/27 (70%) Frame = +1 Query: 61 RERAHIILQFTRQSDNEQNPQSIQDTS 141 +ERAH +L F ++ NE+N +S+ + S Sbjct: 1281 KERAHDLLNFIKKDTNEKNSESVDNKS 1307
>RS16_COXBU (Q83E83) 30S ribosomal protein S16| Length = 137 Score = 29.3 bits (64), Expect = 2.5 Identities = 14/40 (35%), Positives = 22/40 (55%) Frame = +2 Query: 14 GYMCPLNLGSDINLGVENEHTSYCSSPGSQTMSKIHNPYK 133 GY P+ G DI L +E E S+ + G+QT ++ + K Sbjct: 37 GYYNPMARGQDIRLQLEKERISHWLNQGAQTSLRVKHLIK 76
>MSU1_YEAST (P39112) Exoribonuclease II, mitochondrial precursor (EC 3.1.13.1)| (Ribonuclease II) (RNase II) (Mitochondrial biogenesis MSU1 protein) Length = 969 Score = 28.1 bits (61), Expect = 5.5 Identities = 13/47 (27%), Positives = 27/47 (57%) Frame = +1 Query: 1 NQYSRLYVPTKFGL*HKFRSRERAHIILQFTRQSDNEQNPQSIQDTS 141 + Y+ + T G + +S+++A + L TR+ DN+Q +++ D S Sbjct: 17 HSYTPCFRVTTRGKRQRSKSKQQAKVELDHTRELDNDQATETVVDRS 63
>HOMEZ_RAT (Q8K3E9) Homeobox and leucine zipper protein Homez (Homeodomain| leucine zipper-containing factor) Length = 513 Score = 28.1 bits (61), Expect = 5.5 Identities = 12/33 (36%), Positives = 22/33 (66%), Gaps = 1/33 (3%) Frame = +1 Query: 205 DMTLFCI-YGMEGEKIQDNTTSRRTRAGTSWTS 300 D+ L C+ +G++ EK++ ++R R G SW+S Sbjct: 60 DIALLCLRHGLQMEKVKTWFMAQRLRCGISWSS 92
>HOMEZ_MOUSE (Q80W88) Homeobox and leucine zipper protein Homez (Homeodomain| leucine zipper-containing factor) Length = 518 Score = 28.1 bits (61), Expect = 5.5 Identities = 12/33 (36%), Positives = 22/33 (66%), Gaps = 1/33 (3%) Frame = +1 Query: 205 DMTLFCI-YGMEGEKIQDNTTSRRTRAGTSWTS 300 D+ L C+ +G++ EK++ ++R R G SW+S Sbjct: 60 DIALLCLRHGLQMEKVKTWFMAQRLRCGISWSS 92
>RGAP1_HUMAN (Q9H0H5) Rac GTPase-activating protein 1 (MgcRacGAP)| Length = 632 Score = 27.7 bits (60), Expect = 7.2 Identities = 11/34 (32%), Positives = 18/34 (52%) Frame = -3 Query: 158 IRYRLLLVSCMDCGFCSLSDCRVNCNMMCARSLL 57 I++ L + C DC S +CR C + C +L+ Sbjct: 307 IKFGKLSLKCRDCRVVSHPECRDRCPLPCIPTLI 340
>APH1_SCHPO (P49776) Bis(5'-nucleosyl)-tetraphosphatase [Asymmetrical] (EC| 3.6.1.17) (Diadenosine 5',5'''-P1,P4-tetraphosphate asymmetrical hydrolase) (Diadenosine tetraphosphatase) (Ap4A hydrolase) (Ap4Aase) Length = 181 Score = 27.7 bits (60), Expect = 7.2 Identities = 17/63 (26%), Positives = 26/63 (41%) Frame = +1 Query: 172 VHIHIITLQHVDMTLFCIYGMEGEKIQDNTTSRRTRAGTSWTSSHGTPHSLLRRWHHDDD 351 VH+HII + D + + E EK + N S + P S+ + D+D Sbjct: 95 VHVHIIPRKKADFSENDLVYSELEKNEGNLASLYLTGNERYAGDERPPTSMRQAIPKDED 154 Query: 352 RAP 360 R P Sbjct: 155 RKP 157
>RGAP1_MOUSE (Q9WVM1) Rac GTPase-activating protein 1 (MgcRacGAP)| Length = 628 Score = 27.3 bits (59), Expect = 9.3 Identities = 15/46 (32%), Positives = 20/46 (43%) Frame = -3 Query: 158 IRYRLLLVSCMDCGFCSLSDCRVNCNMMCARSLLLNLCQSPNLVGT 21 I++ L + C DC S +CR C + C P LVGT Sbjct: 308 IKFGKLSLKCRDCRLVSHPECRDRCPLPCI----------PPLVGT 343 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 52,427,771 Number of Sequences: 219361 Number of extensions: 974402 Number of successful extensions: 2719 Number of sequences better than 10.0: 9 Number of HSP's better than 10.0 without gapping: 2659 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2719 length of database: 80,573,946 effective HSP length: 97 effective length of database: 59,295,929 effective search space used: 1423102296 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)