Clone Name | rbart37h09 |
---|---|
Clone Library Name | barley_pub |
>CHIT1_TULBA (Q9SLP4) Chitinase 1 precursor (EC 3.2.1.14) (Tulip bulb| chitinase-1) (TBC-1) Length = 314 Score = 64.3 bits (155), Expect = 1e-10 Identities = 35/89 (39%), Positives = 52/89 (58%), Gaps = 1/89 (1%) Frame = -1 Query: 429 ANTDVQTYVMFYDRQTGYYPGAKVLASLQTGKTTEELGLLSPDQGIAAAKELLR-QNKLP 253 A T V+ ++ +++ Q+ Y G KVL S +T+ G L PD G A +L+ Q KL Sbjct: 217 ARTSVEQFLKYFEEQSSNYHGGKVLVSF----STDSSGGLKPDNGFFRACSILKKQGKLH 272 Query: 252 GFFIWSADSSKQSDYKFTYETRAQEIVAN 166 G F+WSAD S S+ F YE +AQ ++A+ Sbjct: 273 GIFVWSADDSLMSNNVFRYEMQAQSMLAS 301
>CHIT2_TULBA (Q7M443) Chitinase 2 (EC 3.2.1.14) (Tulip bulb chitinase-2) (TBC-2)| Length = 275 Score = 59.7 bits (143), Expect = 3e-09 Identities = 33/85 (38%), Positives = 49/85 (57%), Gaps = 1/85 (1%) Frame = -1 Query: 417 VQTYVMFYDRQTGYYPGAKVLASLQTGKTTEELGLLSPDQGIAAAKELLR-QNKLPGFFI 241 V+ ++ +++ Q YPG KVL S +T+ G L P G A +L+ Q KL G F+ Sbjct: 195 VEQFLKYFEMQRSNYPGGKVLVSF----STDNSGGLKPRNGFFDACSILKKQGKLHGIFV 250 Query: 240 WSADSSKQSDYKFTYETRAQEIVAN 166 WSAD S S+ F YE +AQ ++A+ Sbjct: 251 WSADDSLMSNDVFKYEMQAQSLLAS 275
>CARB_SYNY3 (Q55756) Carbamoyl-phosphate synthase large chain (EC 6.3.5.5)| (Carbamoyl-phosphate synthetase ammonia chain) Length = 1081 Score = 31.2 bits (69), Expect = 1.1 Identities = 21/62 (33%), Positives = 32/62 (51%), Gaps = 2/62 (3%) Frame = -1 Query: 429 ANTDVQTYVMFYDRQTGYYPGAKVLASLQTGKTTEELGLLSP--DQGIAAAKELLRQNKL 256 AN V + + TG P AK+ + + +GKT EELG+ Q +A + +L +K Sbjct: 850 ANPRASRTVPYVSKATGR-PLAKIASLVMSGKTLEELGVTEEFIPQHVAVKEAVLPFSKF 908 Query: 255 PG 250 PG Sbjct: 909 PG 910
>CARB_ANASP (Q8YQL2) Carbamoyl-phosphate synthase large chain (EC 6.3.5.5)| (Carbamoyl-phosphate synthetase ammonia chain) Length = 1104 Score = 30.0 bits (66), Expect = 2.4 Identities = 22/62 (35%), Positives = 29/62 (46%), Gaps = 2/62 (3%) Frame = -1 Query: 429 ANTDVQTYVMFYDRQTGYYPGAKVLASLQTGKTTEELGLLSP--DQGIAAAKELLRQNKL 256 AN V F + TG P AK+ + + +GKT EEL IA + +L NK Sbjct: 872 ANPRASRTVPFVSKATGV-PLAKLASLIMSGKTLEELNFTQEVIPSHIAVKEAVLPFNKF 930 Query: 255 PG 250 PG Sbjct: 931 PG 932
>KPRS_BACSU (P14193) Ribose-phosphate pyrophosphokinase (EC 2.7.6.1) (RPPK)| (Phosphoribosyl pyrophosphate synthetase) (P-Rib-PP synthetase) (PRPP synthetase) Length = 317 Score = 29.3 bits (64), Expect = 4.1 Identities = 15/50 (30%), Positives = 26/50 (52%), Gaps = 1/50 (2%) Frame = -1 Query: 399 FYDRQTGYYPGAKVLASLQTGKTTEELGLLSPDQ-GIAAAKELLRQNKLP 253 F+D + G +L GK E++ ++SPD G+ A++L + K P Sbjct: 143 FFDIPIDHLMGVPILGEYFEGKNLEDIVIVSPDHGGVTRARKLADRLKAP 192
>AKIB1_MOUSE (Q6ZPS6) Ankyrin repeat and IBR domain-containing protein 1| (Fragment) Length = 1087 Score = 28.9 bits (63), Expect = 5.4 Identities = 15/39 (38%), Positives = 22/39 (56%) Frame = +1 Query: 190 GLIGELVVALLGAVRRPNEEPRQLVLPQQLLGRGDALVR 306 G IG + + L +V R E PR + +LL GD+L+R Sbjct: 883 GAIGSSLPSRLDSVPRSTESPRAALSSSELLELGDSLMR 921
>TRMB_BDEBA (Q6MQU0) tRNA (guanine-N(7)-)-methyltransferase (EC 2.1.1.33)| (tRNA(m7G46)-methyltransferase) Length = 209 Score = 28.1 bits (61), Expect = 9.2 Identities = 9/21 (42%), Positives = 15/21 (71%) Frame = -1 Query: 249 FFIWSADSSKQSDYKFTYETR 187 +F+W+ D +QS YK +ET+ Sbjct: 154 YFLWAMDEIRQSPYKIIFETQ 174
>MOT1_SCHPO (O43065) Probable helicase mot1 (EC 3.6.1.-) (TBP-associated factor| mot1) (Modifier of transcription 1) Length = 1953 Score = 28.1 bits (61), Expect = 9.2 Identities = 11/28 (39%), Positives = 17/28 (60%) Frame = -1 Query: 237 SADSSKQSDYKFTYETRAQEIVANH*SP 154 SAD +DY FT ++R+ +V H +P Sbjct: 317 SADKKTGADYNFTAQSRSDRLVVEHKAP 344
>FMT_RAT (Q5I0C5) Methionyl-tRNA formyltransferase, mitochondrial precursor| (EC 2.1.2.9) (MtFMT) Length = 385 Score = 28.1 bits (61), Expect = 9.2 Identities = 12/20 (60%), Positives = 13/20 (65%) Frame = +3 Query: 285 PRRCLGPERAAPAPRWSCRS 344 PRRC GP A PR SC+S Sbjct: 4 PRRCWGPWLAGRRPRCSCQS 23 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 51,964,542 Number of Sequences: 219361 Number of extensions: 941075 Number of successful extensions: 2598 Number of sequences better than 10.0: 9 Number of HSP's better than 10.0 without gapping: 2551 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2595 length of database: 80,573,946 effective HSP length: 101 effective length of database: 58,418,485 effective search space used: 2395157885 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)