| Clone Name | rbart37h02 |
|---|---|
| Clone Library Name | barley_pub |
>SYT14_HUMAN (Q8NB59) Synaptotagmin-14 (Synaptotagmin XIV) (SytXIV)| Length = 555 Score = 30.0 bits (66), Expect = 3.3 Identities = 15/47 (31%), Positives = 25/47 (53%) Frame = -3 Query: 473 NTTACWRTISISMNSCSQEASRCRVRMARRMPKTWLVLIKSGTRGRL 333 N + C +S+S SCS+ S C+ +P+ + L+ + T GRL Sbjct: 386 NHSGCDSQMSVSEMSCSESTSSCQSLEHGSVPEILIGLLYNATTGRL 432
>UBPW_MOUSE (Q61068) Ubiquitin carboxyl-terminal hydrolase DUB-1 (EC 3.1.2.15)| (Ubiquitin thioesterase DUB-1) (Ubiquitin-specific processing protease DUB-1) (Deubiquitinating enzyme 1) Length = 526 Score = 30.0 bits (66), Expect = 3.3 Identities = 13/42 (30%), Positives = 20/42 (47%), Gaps = 9/42 (21%) Frame = +3 Query: 384 SSCHPNATAGCL---------LTAAVHGDAYCPPAGCRICAL 482 +SC+ NA CL + + H C P GC++CA+ Sbjct: 58 NSCYLNAALQCLTHTPPLADYMLSQEHSQTCCSPEGCKLCAM 99
>SYT14_MOUSE (Q7TN84) Synaptotagmin-14 (Synaptotagmin XIV) (SytXIV)| Length = 555 Score = 29.3 bits (64), Expect = 5.7 Identities = 14/47 (29%), Positives = 23/47 (48%) Frame = -3 Query: 473 NTTACWRTISISMNSCSQEASRCRVRMARRMPKTWLVLIKSGTRGRL 333 N + C +S+S SC S C+ +P+ + L+ + T GRL Sbjct: 386 NPSGCDSQVSLSEASCGDSTSSCQSLQHGSVPEILIGLLYNATTGRL 432
>JAM3_HUMAN (Q9BX67) Junctional adhesion molecule C precursor (JAM-C)| (Junctional adhesion molecule 3) (JAM-3) (JAM-2) Length = 310 Score = 29.3 bits (64), Expect = 5.7 Identities = 15/32 (46%), Positives = 18/32 (56%), Gaps = 4/32 (12%) Frame = +3 Query: 369 PRLRHSSCHPNATAGCLLTAAVH----GDAYC 452 PR R+SS H N+ G L+ AVH G YC Sbjct: 188 PRFRNSSFHLNSETGTLVFTAVHKDDSGQYYC 219
>LEG9_RAT (P97840) Galectin-9 (36 kDa beta-galactoside-binding lectin) (Urate| transporter/channel) (UAT) Length = 354 Score = 28.9 bits (63), Expect = 7.5 Identities = 16/45 (35%), Positives = 22/45 (48%) Frame = -2 Query: 462 LLEDNKHLHEQLQSGGIPLSRSDGKKNA*DVVSPHQVRNSWTPED 328 +L D K H L+ GG + + N VV Q+ NSW PE+ Sbjct: 246 VLPDAKRFHINLRCGGDIAFHLNPRFNEKVVVRNTQINNSWGPEE 290
>JAM3_RAT (Q68FQ2) Junctional adhesion molecule C precursor (JAM-C)| (Junctional adhesion molecule 3) (JAM-3) Length = 310 Score = 28.5 bits (62), Expect = 9.7 Identities = 14/32 (43%), Positives = 19/32 (59%), Gaps = 4/32 (12%) Frame = +3 Query: 369 PRLRHSSCHPNATAGCLLTAAVH----GDAYC 452 PR ++SS H N+ G L+ +AVH G YC Sbjct: 188 PRFQNSSFHVNSETGTLVFSAVHKEDSGQYYC 219 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 65,722,888 Number of Sequences: 219361 Number of extensions: 1195301 Number of successful extensions: 2564 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 2516 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2563 length of database: 80,573,946 effective HSP length: 103 effective length of database: 57,979,763 effective search space used: 3304846491 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)