| Clone Name | rbart37g07 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | CAD23_RAT (P58365) Cadherin-23 precursor (Otocadherin) | 30 | 3.6 | 2 | CAD23_HUMAN (Q9H251) Cadherin-23 precursor (Otocadherin) | 30 | 4.7 | 3 | FLO1_YEAST (P32768) Flocculation protein FLO1 precursor (Floccul... | 29 | 6.1 | 4 | CAD23_MOUSE (Q99PF4) Cadherin-23 precursor (Otocadherin) | 29 | 6.1 | 5 | B3GT3_PONPY (Q5RAL7) Beta-1,3-galactosyltransferase 3 (EC 2.4.1.... | 29 | 6.1 |
|---|
>CAD23_RAT (P58365) Cadherin-23 precursor (Otocadherin)| Length = 3317 Score = 30.0 bits (66), Expect = 3.6 Identities = 20/49 (40%), Positives = 26/49 (53%) Frame = -3 Query: 476 EEVLSSRTPGSSALHGAATWPDQGDVTSTLQYGLGQGDLFLDGYTYLED 330 E VL TPG++ + AA PD+G + + Y L DL GY LED Sbjct: 2301 ERVLEGATPGTTLIAVAAVDPDKG-LNGLITYTL--LDLIPPGYVQLED 2346
>CAD23_HUMAN (Q9H251) Cadherin-23 precursor (Otocadherin)| Length = 3354 Score = 29.6 bits (65), Expect = 4.7 Identities = 19/50 (38%), Positives = 27/50 (54%) Frame = -3 Query: 479 LEEVLSSRTPGSSALHGAATWPDQGDVTSTLQYGLGQGDLFLDGYTYLED 330 +E +L TPG++ + AA PD+G + + Y L DL GY LED Sbjct: 2302 MERILEGATPGTTLIAVAAVDPDKG-LNGLVTYTL--LDLVPPGYVQLED 2348
>FLO1_YEAST (P32768) Flocculation protein FLO1 precursor (Flocculin-1)| Length = 1537 Score = 29.3 bits (64), Expect = 6.1 Identities = 26/87 (29%), Positives = 33/87 (37%), Gaps = 3/87 (3%) Frame = -3 Query: 476 EEVLSSRTPGSSALHGAATWPDQGDVTST---LQYGLGQGDLFLDGYTYLEDFMPLPYGL 306 E V+ RTP S L T P G TST + G + D T + P GL Sbjct: 892 ETVIVIRTPTSEGLISTTTEPWTGTFTSTSTEMTTVTGTNGVPTD-ETVIVIRTPTSEGL 950 Query: 305 DH*SAEPWVGRIDRLAPRVCKVYANNG 225 + EPW G + V + NG Sbjct: 951 ISTTTEPWTGTFTSTSTEVTTITGTNG 977
>CAD23_MOUSE (Q99PF4) Cadherin-23 precursor (Otocadherin)| Length = 3354 Score = 29.3 bits (64), Expect = 6.1 Identities = 20/49 (40%), Positives = 26/49 (53%) Frame = -3 Query: 476 EEVLSSRTPGSSALHGAATWPDQGDVTSTLQYGLGQGDLFLDGYTYLED 330 E VL TPG++ + AA PD+G + + Y L DL GY LED Sbjct: 2303 ERVLEGATPGTTLIAVAAVDPDKG-LNGLITYTL--LDLTPPGYVQLED 2348
>B3GT3_PONPY (Q5RAL7) Beta-1,3-galactosyltransferase 3 (EC 2.4.1.79)| (Beta-1,3-GalTase 3) (Beta3Gal-T3) (b3Gal-T3) (Galactosylgalactosylglucosylceramide beta-D-acetyl-galactosaminyltransferase) (UDP-N-acetylgalactosamine:globotriaosylceramide beta-1,3-N-a Length = 331 Score = 29.3 bits (64), Expect = 6.1 Identities = 18/62 (29%), Positives = 28/62 (45%), Gaps = 2/62 (3%) Frame = -1 Query: 292 PSRGSGGSIGWLLAYVKYMQIMAAWILHLPELRVL--V*SVHFYVYVSCQLEICVFAIEL 119 PSR S S+ W L + + + W L LP V+ V ++FY Y + F + Sbjct: 10 PSRMSLRSLQWSLLLLSLLSFLVMWYLSLPHYNVIERVNWMYFYEYEPIYRQDFHFTLRE 69 Query: 118 HA 113 H+ Sbjct: 70 HS 71 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 72,567,377 Number of Sequences: 219361 Number of extensions: 1539948 Number of successful extensions: 4220 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 4050 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4201 length of database: 80,573,946 effective HSP length: 104 effective length of database: 57,760,402 effective search space used: 3523384522 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)